KEGG   Leishmania braziliensis: LBRM_25_1690Help
Entry
LBRM_25_1690      CDS       T01113                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
lbz  Leishmania braziliensis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:lbz00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    LBRM_25_1690
Translation factors [BR:lbz03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    LBRM_25_1690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
25:complement(625304..625939)
Genome map
AA seq 211 aa AA seqDB search
MDNYDNAEHDNFGYEDDEYDDAADDWEVEAAEEEQKAIAEEAARKARLEKKLVTRAPVRK
EEEEEAVPEDVERAIADMRQVANDIASGSTLLRGGSSEELIGNHKLVADVDVDRVGAMIA
DRLTSFSESSHYDKLILEVFERLTSHLTNTQLLNEEADRVHRLREELKRAAKTKTKPVEK
APVTQSGLDLSNFEDKGGAAVTEENEDETGW
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggacaactacgacaatgccgagcacgacaacttcggatatgaggatgacgagtacgac
gacgctgcggatgactgggaggtcgaggccgcagaagaggagcagaaggccatcgccgag
gaggccgctcgcaaagctcgcttagagaagaagttggtcactcgtgccccagtgaggaag
gaagaagaggaagaggcggtgccagaggatgtggagcgtgcgattgcagacatgcgacag
gtggccaacgacatcgcctccggtagcacccttctccgcggaggaagctcggaggagctc
attgggaaccataagctggttgcagacgtggacgtggaccgggtaggcgccatgattgcc
gatcgtctcacgtccttctccgaatcctcccactacgacaagctgatcctggaagtcttt
gagcgcttgaccagccacctgacgaacacgcagctgctgaacgaggaggcggatagggta
caccgtctgcgtgaggagctcaagcgtgcggcgaagacaaagacgaagccggtggagaag
gcgccggttacacagagcggcctcgatctgtctaactttgaggacaaaggtggcgccgcc
gtcacggaagagaatgaggatgagacaggctggtag

DBGET integrated database retrieval system