KEGG   Leishmania braziliensis: LBRM_26_2640Help
Entry
LBRM_26_2640      CDS       T01113                                 

Definition
putative glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
lbz  Leishmania braziliensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lbz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LBRM_26_2640
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LBRM_26_2640
Enzymes [BR:lbz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     LBRM_26_2640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
26:979994..980788
Genome map
AA seq 264 aa AA seqDB search
MAEVLKLVKRIVVKVGSSILVENQEIASHRIEALCRFVAELQARYEVILVTSGAVAAGYT
KKEMDKSFVPNKQALASMGQPLLMHMYYTEFQKHGILCAQMLLAAYDLDSRKRTINAHNT
IEVLLSHKVIPIINENDATALHELVFGDNDRLSALVAHRFKADLLVILSDIDGYYTANPR
TCTDAKIRKVVHEIDPSELVAEATPNNRFATGGIVTKLQAAQFLLERGGKMYLSSGFQLE
TVRDFLIGGHHELGTLFYPRVLSA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggttttgaagttggtgaagcgtatcgtggtaaaggtaggctcctcaatcctc
gtggagaaccaggagatcgcctcgcaccgcattgaggcgctatgccgatttgtagcagag
ctgcaggccaggtatgaggttatccttgtcacctccggcgcagtcgccgcgggctacaca
aagaaggagatggacaagtcatttgtgcccaataagcaggcactcgcatcgatggggcag
ccgctactcatgcacatgtactacaccgagtttcaaaagcacggtatcctgtgcgcgcag
atgctccttgccgcctatgaccttgactcgcgcaagcgaaccatcaacgcccacaacacc
atcgaggtgctcctcagccacaaggtgatccccattatcaacgaaaacgacgcgacggcg
cttcacgagctggtctttggcgacaacgaccgtctttcggcccttgtcgcgcaccgcttc
aaggcggatcttctcgtcattcttagcgatatcgacggctactacacagcgaatccgcgg
acctgcacagatgctaagatccgcaaagtcgtccatgagatcgaccctagcgagctggtg
gccgaggcaaccccgaacaatcgattcgcgacggggggcattgtgacaaagctccaggct
gctcagttcctcctggagaggggcgggaagatgtacctctcgagcggctttcaactggag
acggtgcgcgacttccttattggcggacaccatgagctgggcacgctgttttatccgaga
gtcctctccgcttga

DBGET integrated database retrieval system