KEGG   Leishmania braziliensis: LBRM_26_2670Help
Entry
LBRM_26_2670      CDS       T01113                                 

Definition
putative glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
lbz  Leishmania braziliensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lbz01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:lbz00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
26:988990..989784
Genome map
AA seq 264 aa AA seqDB search
MAEVLKLVKRIVVKVGSSILVENQEIASHRIEALCRFVAELQARYEVILVTSGAVAAGYT
KKEMDKSFVPNKQALASMGQPLLMHMYYTEFQKHGILCAQMLLAAYDLDSRKRTINAHNT
IEVLLSHKVIPIINENDATALHELVFGDNDRLSALVAHRFKADLLVILSDIDGYYTANPR
TCTDAKIRKVVHEIDPSELVAEATPNNRFATGGIVTKLQAAQFLLERGGKMYLSSGFQLE
TVRDFLIGGHHELGTLFYPSVLSA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggttttgaagttggtgaagcgtatcgtggtaaaggtaggctcctcaatcctc
gtggagaaccaggagatcgcctcgcaccgcattgaggcgctatgccgatttgtagcagag
ctgcaggccaggtatgaggttatccttgtcacctccggcgcagtcgccgcgggctacaca
aagaaggagatggacaagtcatttgtgcccaataagcaggcactcgcatcgatggggcag
ccgctactcatgcacatgtactacaccgagtttcaaaagcacggtatcctgtgcgcgcag
atgctccttgccgcctatgaccttgactcgcgcaagcgaaccatcaacgcccacaacacc
atcgaggtgctcctcagccacaaggtgatccccattatcaacgaaaacgacgcgacggcg
cttcacgagctggtctttggcgacaacgaccgtctttcggcccttgtcgcgcaccgcttc
aaggcggatcttctcgtcattcttagcgatatcgacggctactacacagcgaatccgcgg
acctgcacagatgctaagatccgcaaagtcgtccatgagatcgaccctagcgagctggtg
gccgaggcaaccccgaacaatcgattcgcgacggggggcattgtgacaaagctccaggct
gctcagttcctcctggagaggggcgggaagatgtacctctcgagcggctttcaactggag
acggtgcgcgacttccttattggcggacaccatgagctgggcacgctgttttatccgagt
gtcctctccgcttga

DBGET integrated database retrieval system