KEGG   Leishmania braziliensis: LBRM_27_1560Help
Entry
LBRM_27_1560      CDS       T01113                                 

Definition
putative ethanolamine kinase
Organism
lbz  Leishmania braziliensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
27:582638..584566
Genome map
AA seq 642 aa AA seqDB search
MAQITNMSITDNPHLRPIEIMEVILTHCAPVLWRHDKARLKNAPEWAAKLHALLNSKVKG
VDDSSCQPLELSASQRPVMPQKSQDGFLTASVDVTACQESAKVSQPPQATPTPPPPLSQQ
GPQIPPPPPKHATAGAALPHTIPVVQCSSVSVDVTHHAACSNASTFSRSSTCSSTSRQHY
PEVGAGNNRVCNPHPGPPPSVAPGASFSPCHNTKEYFEECGLPLTSATTHHGKVTVVSEN
DLLLSERSNTRELPSVPLQVKRLSGGITNELFHVYDEDHPSTSVVVRVFGKETDRVISRE
SELFYQSLFIPTYICGSNFLVYDFLDGYYTLPYQEMAAEATPIARAIAVFQVRATRAALR
DHAPPLLRDSQNKDYWKDVNDQLLAEEGSTTSSRSTHRGESRFDRESNYLIGSLTKWVDL
VLSKEIVDKVHEDRRGSFLETARSLQSACAWIVSMLKRQETFLPEGVCHNDLLSANVMIH
KVRKDVRVIDFDYTKRNFLLYDVANHFNEYSGLDCDYDTYFPSDAHMSAFIAEYRRAMRD
ALEASWAENSILTASTDGASREHEIFPNARELFWSDSEEAEVEVVARWTQLAKLLTLASH
LSWSVWSLLQEAVSALDVDFLNYAQARYNRYLAVRVECSGNL
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagattacgaatatgtcgatcaccgataatccgcacctgcggccgatcgagatt
atggaggtgattctcactcattgtgcccctgtgctgtggcgacacgacaaggcgaggctg
aagaatgctccggagtgggcggcgaagctgcacgctttgctcaacagcaaggtgaaggga
gtcgatgacagcagctgccagccgctggagctgagcgcgagtcaacggccggtgatgccg
cagaagagtcaggatggcttcctcactgcctcggtggatgtgactgcgtgccaggaaagc
gcaaaggtaagccagccgccacaggccacacccactccgccgccaccgttatcgcagcag
ggccctcaaatccctcctcctcctcccaagcatgccacggccggtgcagctctcccccac
acgatcccggtagtgcagtgcagcagtgtctccgttgacgtgacacaccacgcggcgtgc
tcaaatgcgagcacctttagccgaagcagcacatgcagcagcacgagccgacaacactat
cccgaggtcggtgcaggcaacaaccgcgtatgcaacccccaccctgggccaccaccgtct
gtcgcacccggcgcatcgttctcgccctgccacaacaccaaggagtactttgaggagtgc
ggcttgccactgacaagcgcgacaacgcaccatggcaaggtgactgtggtaagcgagaac
gacttgctactgagcgagcgcagcaacacgcgtgagctcccctccgtgcccctgcaggtg
aagcgtttgtcaggcggcatcactaatgagctcttccacgtctacgacgaagaccaccca
tccacgtcggtggtggtgcgcgtctttggcaaggagacggatcgcgtcatctcacgcgag
agcgagctcttctaccagtctctcttcatccccacctatatctgcggcagtaacttcctc
gtgtacgatttcttggatggatactacacgttgccgtaccaggaaatggcggcggaggcg
acaccaatcgcacgcgccatcgcggtattccaggtgcgggccacacgcgccgccctgcgc
gaccacgctcctcctctgctgcgagactcacagaacaaggactattggaaggacgtaaac
gaccaactgctcgcagaggaggggagcacgacgagtagccgcagtacccacaggggtgag
tcccgctttgaccgcgagtcgaactacttgataggctcgctgacgaagtgggtggaccta
gtgctgtcgaaagagatcgtcgacaaggtgcacgaggacaggcgggggagctttctcgaa
acggcacgcagtctgcagtcggcctgcgcgtggatagtatcgatgctgaagcgccaggag
accttcttgccggagggcgtctgccacaacgatctgctgagcgccaacgtgatgatccac
aaggtgcgcaaggacgtgcgggtgatagattttgattacacaaagcgcaacttcctgctg
tacgatgtcgctaatcactttaacgagtactctggcctcgactgcgactacgacacctac
ttcccgtcggatgcgcacatgtccgccttcattgccgagtaccgtcgcgctatgcgtgac
gcactcgaggcgagctgggcggagaactccatcctcacagcctccacagatggcgcttct
cgagagcacgagatcttccccaacgcgcgggagctgttctggagcgacagcgaagaagcg
gaggtagaggtggtggcgcgctggacccaactcgcgaagctgctcaccctggcttcgcac
ctgtcgtggagtgtgtggtcgctgctgcaggaggccgtgtctgccctggatgttgacttt
ctcaactacgcccaggcccgctacaaccgctacctcgccgtgcgagttgagtgctcgggg
aatctttga

DBGET integrated database retrieval system