KEGG   Leishmania braziliensis: LBRM_27_1750Help
Entry
LBRM_27_1750      CDS       T01113                                 

Definition
putative eukaryotic translation initiation factor eIF-4E
Orthology
K03259  
translation initiation factor 4E
Organism
lbz  Leishmania braziliensis
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:lbz03013]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
27:671247..671888
Genome map
AA seq 213 aa AA seqDB search
MSAPSSAPPHKMTNLHKLQRAWTLWYDSPSTYNTENWEMSLVPIMTVRSVEEFFVMLRYM
KPLHALRTSSQYHFFQEGVKPMWEDPVNKKGGKLWVNLDITSSNGRSSNNSSSAAAADGS
AAEAKTDLDKAWENVLMATVGEYLDCVEKKDASAEPFVTGIVMSKRKYHNRLAVWVSDAS
ATDKIEVLKKALTKEASLAPIASIVFTKHGEAS
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtcagctccatcttccgctcctcctcacaaaatgacgaacctgcataagctgcagcgt
gcctggacgctctggtacgatagtccatcgacgtacaacacggaaaactgggagatgtcc
ttggtgcccattatgaccgtgcgctccgtggaggagttcttcgttatgctccggtacatg
aagcctcttcacgccctgcgcacctcctcgcagtaccacttcttccaggaaggtgtgaag
cccatgtgggaggacccggtaaacaagaagggtggaaagctctgggtgaaccttgatatc
accagctccaatggtcggagcagtaacaactccagcagcgctgcagcagccgatggcagc
gcggcggaggccaagactgaccttgataaggcatgggagaatgttctgatggccactgta
ggcgaatatcttgactgcgtagagaagaaggacgcatcagcggagccgttcgtgacgggt
attgtcatgtcgaagcgtaaataccacaaccgtctcgccgtgtgggtgagcgatgcatca
gcaacggacaagatcgaggtgctgaagaaggcgctaacaaaggaggcgagcttggcgccg
attgcatccattgtcttcacaaagcacggcgaggcttcttag

DBGET integrated database retrieval system