KEGG   Leishmania braziliensis: LBRM_28_0220Help
Entry
LBRM_28_0220      CDS       T01113                                 

Definition
histone H2B variant
Orthology
K11252  
histone H2B
Organism
lbz  Leishmania braziliensis
Brite
Exosome [BR:lbz04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LBRM_28_0220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
28:73200..73628
Genome map
AA seq 142 aa AA seqDB search
MPPTKGGKRPIPLGGKGKGKRSAGKAPKSASDRKRRHNQKRNQHWDLYIHRALRRFFKRG
TLSKAAVRVLSSFIEDMFNRIQTEAVFVAKINKVKTLTAREIQTSARLLLPPELAKHAMS
EGTKAVAKYNASRGEAYAQGGM
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgcctccaaccaagggtggaaagcgcccgatcccgctcgggggtaagggtaagggcaag
cgttcggcgggtaaggcacccaagtcggccagtgatcgcaagcgccgccacaatcagaag
cgcaaccagcactgggacctgtacatacaccgcgctttgcgccgcttcttcaagcgcggc
acgctgagcaaggctgccgtgcgcgtgctttcttcctttattgaggatatgttcaaccgc
attcagaccgaggccgtcttcgtcgccaagatcaacaaggtgaagacgctgacggctcgc
gaaatccagacttcggcccgtctgctgctgccgccggagctggcgaagcatgccatgagc
gagggaaccaaggccgtcgccaagtacaacgcttcccgcggtgaggcatatgctcagggt
ggcatgtag

DBGET integrated database retrieval system