KEGG   Leishmania braziliensis: LBRM_28_0710Help
Entry
LBRM_28_0710      CDS       T01113                                 

Definition
putative serine/threonine protein phosphatase catalytic subunit
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
lbz  Leishmania braziliensis
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:lbz00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    LBRM_28_0710
Enzymes [BR:lbz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     LBRM_28_0710
Protein phosphatases and associated proteins [BR:lbz01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     LBRM_28_0710
Transcription machinery [BR:lbz03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     LBRM_28_0710
Spliceosome [BR:lbz03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    LBRM_28_0710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
28:complement(256449..257354)
Genome map
AA seq 301 aa AA seqDB search
MSVDSIIEQLLEVRGAKPGKQVQLAENDVKQLTLRTREIVLSQPPLLELEAPIKICGDIH
GQYYDLIRLFENGGFPPTANYLFLGDYVDRGKQGLETICLVFAFKVKFPENFFILRGNHE
CASINRIYGFFDECKRRYNIRLWKAFTDTFNCLPVACIIDDKIFCCHGGLSPELQTMDQI
KKITRPCDVADTGLICDLLWSDPEEGLSGWGENDRGVSFTFGQDIVEKFLNKHQFELICR
AHQVVEDGYQFFAKRKLITIFSAPNYCNEFDNSGAVMTVDNELMCSFQILKPSVKKPKFY
S
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcgactccattatcgaacagctgctcgaggtgcgtggtgcgaagcccggtaaa
caggtacagttagccgagaatgatgtgaagcagttgacgctgcgcacacgcgagattgtt
ctctcgcagccgcctctgctagagctggaggcgcccattaagatatgcggtgacattcat
ggtcagtactacgacctcatccgtctcttcgagaatggcggcttcccgccgacagcgaac
tacctcttcctcggcgattatgtggaccgcggaaagcaaggtctcgaaacgatttgcttg
gtctttgccttcaaggtaaagtttcccgaaaactttttcatcttgcgaggcaaccacgag
tgtgccagcatcaaccgcatctacggcttcttcgacgagtgcaagcgccgctacaatatc
cgcctctggaaggcctttacagacacgtttaactgtcttcccgtggcgtgcattattgat
gacaagatcttctgctgccacggtggcctttcaccggagctgcagacgatggaccagatc
aagaagatcactcgtccgtgcgatgtggcggacactggcctgatctgcgacctgctgtgg
tcagacccagaggaaggtctctctgggtggggtgagaacgaccgcggtgtgtccttcacc
ttcggccaggatattgtagagaagttcttaaacaagcaccaatttgagctgatttgccgc
gctcatcaggtcgtagaggatgggtaccagtttttcgcgaagcgcaagcttatcacaatc
ttctctgcccctaactactgtaatgagttcgataacagtggcgccgtgatgactgtcgac
aacgagcttatgtgctcttttcagatcctcaagccgtctgtgaagaagccgaagttctac
tcgtag

DBGET integrated database retrieval system