KEGG   Leishmania braziliensis: LBRM_28_1340Help
Entry
LBRM_28_1340      CDS       T01113                                 

Definition
putative p450 reductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
lbz  Leishmania braziliensis
Brite
Enzymes [BR:lbz01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     LBRM_28_1340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
28:463278..465227
Genome map
AA seq 649 aa AA seqDB search
MSLLFIVATLLISLAGYLYFQLKRQASGRCAAASTTANPTRKEECGTPSPTTAALLSGSG
SVDKVQKEVTVLFGSQTGTAEMFAKTLTREGAKLGVPIRVLDVDGYETYNMEDERLIILI
CATYGEGESTDTMKGFHDWMMDECRSPGEELANVKYAVFGLGDRQYKYFCEEGIVMDRRF
EELGAQRIFGLGCGDSGNGQLEEQFDEWCRDLWPAVGRALNITIKQNSEEPVEPQCRMKY
WENAEESLAFPKTASVLEPTQRLPMWVPVIRNEELLHKAEGYSTRAIDFSIKDTIISYQA
GDHLGILPCNSDELVSQYLQILSVSDEEAGRIFSLQDKKTLKNVLPARVSARTALKWYID
LAGPPKKSTLRAFAHCCTDPLQREELLRILRVNQDAQKEFSKLCGKLRTMFGFLRKFDSA
KVPLPFFLELMPRIAPRYYSISSDLLATPTLVGTTVGIVDGGLCTNMLARMQVGDKVPVF
VRKSTFHLPMRHKERPLVMIGTGTGVAPFIGFIARRGVWKQKGTELGKAILFFGCRRHAE
DHIFEDYCTAALHEGVLSALVVAYSRDQADKVYVQHRLRERGAEIWEMMVSGANVYLCGD
ARRMARDVEAELKRIVEVEGQMSREAAGEYIEKMGKEDRYLKDVWSSTL
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgtctctcctcttcattgtcgctacgctgctgatctccctggcggggtacctctacttc
cagctgaagcggcaggcctcaggacgctgcgccgccgcgtccaccaccgctaatcctact
cgaaaggaggagtgtggcacgccgtcgcccaccactgccgctctcctcagcggcagtggt
tcagtggacaaagtccagaaagaggttaccgtcctttttggatcacagaccggcacagcc
gaaatgtttgccaagacgctgacccgcgagggagcgaagctcggtgtccccatcagggtg
ctcgacgtcgacggttacgagacgtacaacatggaggacgagcgccttatcattctaatc
tgcgccacctacggcgagggcgagtcgacagacacaatgaagggcttccacgactggatg
atggacgagtgccgctccccaggggaggagctggcgaacgtcaaatacgctgtgtttggc
ctaggtgatcgccagtacaagtacttctgcgaggagggcatcgtcatggaccgccgcttc
gaagagctaggggcacagcgcatttttgggcttggttgcggcgactcgggcaatgggcag
ctggaggagcagttcgacgagtggtgcagggacctctggcccgcagttgggcgtgctctg
aacatcactatcaagcagaactcggaggagccggtggagccacagtgccgaatgaagtac
tgggaaaacgctgaggaatccctcgcgttccccaagacggcctccgtactggagccgacg
cagcggctgccgatgtgggtgcccgtcatacgcaatgaggagctgctgcacaaggcggag
gggtacagcacccgcgccatcgacttcagcatcaaggacaccatcatctcttaccaagcc
ggtgatcacctcggcatcctgccctgcaactcggatgagctcgtctcgcaatacctgcaa
atcctcagtgtctctgatgaggaggccggccgcatcttttccctacaggacaagaagacg
ctcaagaacgttctcccggcccgtgtgtcggcgcgcacagcgctcaagtggtacatcgat
ctcgccgggcccccgaagaagtcgacgctgcgtgcctttgctcactgctgcactgacccc
ctgcagagggaggagctgttgcgtattctacgcgtgaaccaggacgcacagaaggagttc
tctaagctatgcggcaagctgcgaactatgttcggcttcctgcgcaagtttgactctgca
aaggtgccgctgcccttcttcctcgaactcatgccccgcatcgcgccccgctactactcc
atctcctccgacctccttgccacccccaccttggtgggaacgacggtcggcatcgttgat
ggcggtctgtgcacgaacatgctcgccaggatgcaggtgggcgacaaggtgccggtgttt
gtgcgcaagtccaccttccacctcccgatgcggcacaaggagcggccactggtgatgatt
ggcaccggcaccggcgtagcgcccttcatcggtttcattgcacgccgtggtgtctggaag
cagaagggcactgagctgggcaaggccatcctcttttttggctgccgccggcacgctgag
gaccacatattcgaggactactgcacagcggcactgcacgaaggggtcctgtcagcgctg
gtggtcgcgtacagtcgcgaccaagccgacaaggtgtacgtccagcaccggctgagggag
cgaggggcggagatatgggagatgatggtgtctggcgccaacgtctacctctgcggtgac
gcgcggcgcatggccagggacgtagaggcggaactcaagcgcatcgtggaggtggagggc
caaatgtcccgcgaagccgctggcgaatacatcgaaaagatgggaaaagaggatcgctac
ctcaaggatgtgtggtcgtcaaccttgtag

DBGET integrated database retrieval system