KEGG   Leishmania braziliensis: LBRM_28_2620Help
Entry
LBRM_28_2620      CDS       T01113                                 

Definition
putative 2-oxoglutarate dehydrogenase, E2 component,dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
lbz  Leishmania braziliensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lbz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LBRM_28_2620
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LBRM_28_2620
  Amino acid metabolism
   00310 Lysine degradation
    LBRM_28_2620
Enzymes [BR:lbz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     LBRM_28_2620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
28:964056..965231
Genome map
AA seq 391 aa AA seqDB search
MLRRVSTRVLPAACSAAQNVSVRFCLAIKVPTIAESISTGKVVNWTKKVGDAVAEDEVIC
QIESDKLNVDVRAPANGVITKINFEEGADVEVGAELSTMKEGPAPSAAAPQVAAVKSDPP
KAAAPTAEAPKAVARAAAEPAATAAVAKPAMHAVAGADPRTKSVRISSMRRRIADRLKAS
QNTCAMLTTFNEIDMTPLIQLRDKYKDDFHKRHAVKLGLMSPFVKASAMALRDVPIVNAS
FGKDTIDYHEFVDIAIAVATPRGLVVPVIRDVQNMNLANIETAIADYAARARINKLTMAE
MTGGTFTISNGGVFGSWMGTPIINPPHSAILGMHAIKKKAWVVGNEIKIRDIMAVALTYD
HRLIDGSDAVTFLVKVKNLIEDPARMVLDLS
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgctccgtcgtgtgtcgacgcgcgtgttgcctgcggcgtgcagtgcggcccagaacgtg
agcgtacgcttctgcctggccatcaaagtgcctacgattgccgagtccatcagtacgggt
aaggtggtgaactggacgaagaaggtcggcgacgccgtcgcagaggacgaggtgatttgc
cagatcgagtctgacaagctcaacgtcgacgtgcgtgcgccggcgaacggcgtcattacg
aagatcaacttcgaggaaggggctgatgtcgaggtcggcgcggagctgtccacgatgaag
gagggcccggcgccatcggcggctgcaccgcaggttgcggcagtcaagtcggacccaccc
aaggcggcggcacctacggcagaggcaccaaaagctgtagcccgagctgccgcagagcct
gctgctactgcggccgttgccaagcccgcgatgcacgccgttgccggcgcggacccgcgc
acgaaaagcgtccgcatctcctccatgcgccgccgcatcgctgaccgcctcaaggctagc
cagaacacgtgcgcgatgctgaccaccttcaatgagattgacatgaccccgctgattcag
ctgcgcgataagtacaaagacgacttccacaagcgccatgctgtgaagttggggctaatg
tcacccttcgtgaaggcgagcgcgatggcgctcagggatgtgccaattgtgaacgcatcc
tttggcaaggacaccatcgactaccacgagttcgtagatatcgcgatcgccgtggcgaca
ccacgcggcctcgttgtgcctgtgatccgtgatgtgcagaacatgaatttggcaaacatc
gagaccgccatcgccgactacgccgcgcgtgcgcgcatcaacaagctgaccatggctgag
atgactggaggaaccttcaccatatccaacggtggcgtctttgggtcttggatgggcacg
cctatcatcaacccgccgcatagcgcgatccttggcatgcacgcaatcaagaaaaaggcg
tgggtggtgggcaacgagattaagatccgcgacatcatggcggtcgcgctgacctacgac
caccgtctcattgacggtagcgatgcggtgaccttcctagtcaaggtgaaaaatctgatt
gaagacccggcgcgtatggtgctggacctctcgtag

DBGET integrated database retrieval system