KEGG   Leishmania braziliensis: LBRM_28_2620Help
Entry
LBRM_28_2620      CDS       T01113                                 

Definition
putative 2-oxoglutarate dehydrogenase, E2 component,dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
lbz  Leishmania braziliensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:lbz01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:lbz00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:lbz00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
28:964056..965231
Genome map
AA seq 391 aa AA seqDB search
MLRRVSTRVLPAACSAAQNVSVRFCLAIKVPTIAESISTGKVVNWTKKVGDAVAEDEVIC
QIESDKLNVDVRAPANGVITKINFEEGADVEVGAELSTMKEGPAPSAAAPQVAAVKSDPP
KAAAPTAEAPKAVARAAAEPAATAAVAKPAMHAVAGADPRTKSVRISSMRRRIADRLKAS
QNTCAMLTTFNEIDMTPLIQLRDKYKDDFHKRHAVKLGLMSPFVKASAMALRDVPIVNAS
FGKDTIDYHEFVDIAIAVATPRGLVVPVIRDVQNMNLANIETAIADYAARARINKLTMAE
MTGGTFTISNGGVFGSWMGTPIINPPHSAILGMHAIKKKAWVVGNEIKIRDIMAVALTYD
HRLIDGSDAVTFLVKVKNLIEDPARMVLDLS
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgctccgtcgtgtgtcgacgcgcgtgttgcctgcggcgtgcagtgcggcccagaacgtg
agcgtacgcttctgcctggccatcaaagtgcctacgattgccgagtccatcagtacgggt
aaggtggtgaactggacgaagaaggtcggcgacgccgtcgcagaggacgaggtgatttgc
cagatcgagtctgacaagctcaacgtcgacgtgcgtgcgccggcgaacggcgtcattacg
aagatcaacttcgaggaaggggctgatgtcgaggtcggcgcggagctgtccacgatgaag
gagggcccggcgccatcggcggctgcaccgcaggttgcggcagtcaagtcggacccaccc
aaggcggcggcacctacggcagaggcaccaaaagctgtagcccgagctgccgcagagcct
gctgctactgcggccgttgccaagcccgcgatgcacgccgttgccggcgcggacccgcgc
acgaaaagcgtccgcatctcctccatgcgccgccgcatcgctgaccgcctcaaggctagc
cagaacacgtgcgcgatgctgaccaccttcaatgagattgacatgaccccgctgattcag
ctgcgcgataagtacaaagacgacttccacaagcgccatgctgtgaagttggggctaatg
tcacccttcgtgaaggcgagcgcgatggcgctcagggatgtgccaattgtgaacgcatcc
tttggcaaggacaccatcgactaccacgagttcgtagatatcgcgatcgccgtggcgaca
ccacgcggcctcgttgtgcctgtgatccgtgatgtgcagaacatgaatttggcaaacatc
gagaccgccatcgccgactacgccgcgcgtgcgcgcatcaacaagctgaccatggctgag
atgactggaggaaccttcaccatatccaacggtggcgtctttgggtcttggatgggcacg
cctatcatcaacccgccgcatagcgcgatccttggcatgcacgcaatcaagaaaaaggcg
tgggtggtgggcaacgagattaagatccgcgacatcatggcggtcgcgctgacctacgac
caccgtctcattgacggtagcgatgcggtgaccttcctagtcaaggtgaaaaatctgatt
gaagacccggcgcgtatggtgctggacctctcgtag

DBGET integrated database retrieval system