KEGG   Leishmania braziliensis: LBRM_29_1990Help
Entry
LBRM_29_1990      CDS       T01113                                 

Definition
putative serine/threonine protein kinase
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
lbz  Leishmania braziliensis
Pathway
Regulation of autophagy
Brite
KEGG Orthology (KO) [BR:lbz00001]
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    LBRM_29_1990
Enzymes [BR:lbz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     LBRM_29_1990
Protein kinases [BR:lbz01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   LBRM_29_1990
Mitochondrial biogenesis [BR:lbz03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    LBRM_29_1990
  Mitophagy factors
   Other mitophagy factors
    LBRM_29_1990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
29:complement(810411..812849)
Genome map
AA seq 812 aa AA seqDB search
MAQNAYPPSWESSYSHSRSGGPPSYPVLPEQMIGSYVIRETIGRGSFGKVKKGRHVHTGE
YVAIKILNRQKLKSANMDRKIHREIEILQLFSHPNICRLYEVISTPTDMYLIMEYVEGGE
LYDYIVQKGRVRESEARYIFQQIVCAIEYCHHFRVVHRDLKPENILLGTGLQVKLIDFGL
SNITKDGEFLATSCGSPNYAAPEVISGKLYFGPEVDVWSCGVILYALLCGCLPFDEDSIP
LLFSKIKKGKYAMPSNMQAGPRELIQQILVVDPLVRLTVPQIRDNAWFNQRLPMRLSYSE
SIFSVKEDRILSVLVSETAKRLGVRDRDVRKELEHGSGAAYVAYNILLDARRRREIAAEV
RELGMSGDESRGISHAIGTQQTKFQPKAMERELNMGLMLTQSPAMVVLLDEDDATRNKWA
YNRGFFVPASTATFGDTKVSDTSLSDVSGNGGPGGPPAVGSFRITSKVCTGSLIGSGSAG
SSLHAPGSLRGAAGLTGGGSSHRRTGMLSGTGGTAASHLGVGLSDQPRVGSVARKHAMYT
AEEEQFIVENNYGWRIGIMTDWRAEKSLSAIYDVLRSFGMQWKVVSPFRLLARSTAETWS
VVADSTQSPKASTWQNTLNSYPIESSAPIRIGSRSGAPASGSSDDQEGDDVAGSMLRDEE
SIHLQVAHTRRPGAAGRSLVSAPGGGFHTNTSQVARGNYFGNLQGGDEEAAMVAGRTTTS
ILPSVHVTESESASPSSPFNPRDASSLASTSTSAVAETITPPLNPVVLSLYFFRIHERHD
KGYLVDFKVMRNAMVGADLVLLLSDALVRKLG
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagaacgcgtatccaccttcatgggagagcagctactcgcactcccgtagcggt
ggtcccccatcgtacccggtgcttcccgagcagatgatcggcagctacgtcattcgtgag
accatcggccgcggtagctttggcaaggtgaagaaagggcgacatgtgcacactggagag
tacgtcgccattaagatcctcaaccgccaaaaactcaagtctgccaacatggacagaaaa
attcaccgcgagatcgaaatccttcagttgttctctcacccgaacatctgccgtctctac
gaggtcatctccacaccgacggacatgtaccttatcatggagtacgtggagggtggggag
ctgtacgactacattgtgcagaagggccgtgtgcgagaaagcgaggcgcgttacatcttc
cagcagattgtgtgcgccatcgagtactgtcaccacttccgcgtcgtgcatcgagacctg
aaaccagagaacattctgcttggaactgggcttcaggtgaaactaattgactttggtctt
tcgaacatcacgaaggatggcgaattcctcgcaacgtcgtgtgggtcacccaactacgcc
gcaccagaggtcatttccggtaagctgtactttggtcctgaggtggatgtgtggtcttgc
ggcgtcattctttacgcgctgctctgcgggtgtcttccgttcgacgaggacagcattccg
ctccttttcagcaaaatcaagaagggcaagtacgccatgccgtccaacatgcaggcgggg
ccacgggagctcattcagcagatcctcgtcgtagacccactcgtgcgactgaccgtcccg
caaatccgtgacaacgcctggttcaatcagcgcctgccaatgcggctgtcgtacagtgag
tccatcttcagcgtgaaggaggaccgcattttatcggtgttggtcagcgagacagcgaag
cggctgggggtgcgggacagggatgtgcgcaaagagctcgagcacggctccggtgccgcc
tatgtcgcctacaatattctcctggacgcacgccgccgtcgcgagatcgcggctgaggtc
cgagagcttggcatgtccggcgatgagtcccgtgggataagccacgccatcggcacccag
cagacaaagtttcagcccaaggcgatggagcgggagctcaacatgggtctcatgctgaca
cagagccccgcgatggtggtgctgctcgatgaggacgatgcaacgaggaacaagtgggcc
tacaaccgcggcttcttcgtgcctgcctccaccgcaacctttggcgacacgaaggtgagt
gatacgagcctgagtgatgtgagcggcaatgggggtccaggcgggccgcccgcagttggc
tccttccgcatcacctccaaggtctgcaccggatctctgatcggctccggcagcgcaggc
tcttccttgcatgcgccaggcagtctgcgcggcgctgcggggctcacgggcggcggcagc
agccatcggcgtacgggcatgctgtctggcactggcggaaccgccgcctcgcacctaggg
gtgggcctcagcgaccaaccgcgtgtcggatctgtcgcccgaaaacacgccatgtacacc
gcggaggaggagcagtttattgtggagaacaactatggctggcgcatcggcatcatgacg
gactggcgggcagagaaatcgctctccgcgatctatgacgtcttgcgctccttcgggatg
cagtggaaggtggtctcgcctttccgtctcctggcacggtcaacggctgagacatggagt
gtggtagcggactcgacgcaatcccccaaagcatccacgtggcaaaacacactaaactcc
taccccattgaatcctctgcaccgatccgcattggcagccgcagcggcgccccagcgagc
ggcagcagtgacgatcaagagggcgacgacgtcgctggtagcatgctgcgcgacgaggag
tccatccacttacaggtggcccacacccgacgaccaggcgctgcaggtcgcagcctcgtg
agtgcaccaggtggcggcttccacactaacacgagccaggttgcgcgcggcaactacttc
ggcaacctacagggcggagacgaggaagcggcgatggtggctggaagaacgacgacgtcg
atacttccgtcagtgcatgtaaccgagagcgagtcggcgtcgccgtcctcgccgtttaac
cctcgcgatgcgtcctcgttggcgagcacctctacctctgccgttgcggaaacaatcacg
ccgccgctcaaccctgtcgttctctctctttatttctttcgcattcacgagcggcacgat
aaaggttacctggtcgatttcaaggtcatgcggaatgccatggtcggcgcagacctcgtg
ctcctcctctccgatgcgctggtcaggaagctgggctga

DBGET integrated database retrieval system