KEGG   Leishmania braziliensis: LBRM_29_2270Help
Entry
LBRM_29_2270      CDS       T01113                                 

Definition
putative ubiquitin hydrolase
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
lbz  Leishmania braziliensis
Brite
Enzymes [BR:lbz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     LBRM_29_2270
Peptidases [BR:lbz01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   LBRM_29_2270
Exosome [BR:lbz04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LBRM_29_2270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
29:complement(944578..946833)
Genome map
AA seq 751 aa AA seqDB search
MPFPVAHEACPHAWNESAMVSPFPGMTVHRDECAYCCRSCCQGDGVYVCMACHTGLCCEH
LEKHMTICETHVMYTTIKELPAKETDEVKDVNYLGVGAPKEYETAVCCADCQVQFAQVPE
LAVEACSGIINAPEPGAQDSTAGGDVGRLQKPQCPHLVCLEQLPSPFHVHPPTSDDMCSA
EACGCHVNNWMCVTCGAIGCPRPEAGGKGHALQHYELTGHPASVKLGTITAQGADYYCYA
CDDDVDDVHFTAHMAHFGVDVHTAKKTAKTMGELEYDYSSQFDFNKITEAGASLTPSYGP
GHTGIKNIGNSCYLASVVQCLMSLAPFQRFFFPAKSTPHQAQCTADPYTCHHCQTERVAA
GLLSGEFSREGHDLTNSICPRLFKKVFAKQHPEFSTGAQQDAQEYLLYLLEEMQRYVRPN
VNGSAGAGGAQQPVHPSEIMEMVMEHRIECSKCHRVRYTYEKDKCLSLPIPIDPMVASTD
AAATSEAEVLEVEVDAIRPRCSLEDCLRAATLPSSIQCRCEVCGESVTYSTVTRLASFPD
VLPVCIRRTYFDIATHNTKKMDVYVEVPQELELEAYRGIGLQPGEVPMPASSATSAEGPR
ADAHVAAPLQEVDEVALVSVVSMGIDIDVARYALIQTNMNIERAIDYIFSHPHIADDVKA
APPLHSEEQQLTPTRAATAVSVPKSATDGTASYELTAMISHMGASARTGHYVCHIKDAAT
GKWLLFNDEKVGESQNPPFSLAALYFFQRKT
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atgccgttccctgtggcacacgaggcatgtcctcatgcatggaatgagtctgccatggtg
agcccgttccccggaatgacggtgcatcgtgacgaatgcgcgtactgctgccgctcgtgc
tgtcaaggcgacggggtctatgtctgtatggcatgccacacgggtctgtgttgcgagcac
ctagagaagcatatgacaatctgcgagacgcacgtcatgtacacaaccatcaaggaactg
cccgcaaaggagacggatgaagtgaaggatgtgaactaccttggtgtaggggcccctaag
gagtatgagaccgcggtgtgttgcgcagattgccaggtgcagtttgcgcaagtgccggag
ctggctgtggaagcgtgcagcggaatcattaacgcgccggagccaggcgcgcaggacagc
acagctggtggtgatgtgggccgcctgcagaagccgcagtgcccacacctggtgtgtctg
gagcagctgccgagcccctttcatgttcatccacccacttccgacgacatgtgttccgcg
gaagcgtgcggatgccacgtgaacaactggatgtgcgtcacgtgcggtgcgatcggttgc
cctcgtcccgaggcaggcggcaaaggtcatgcgctgcagcactatgagctgacgggacac
ccggctagtgtcaaacttggcaccatcaccgcgcagggcgctgactactactgctacgcc
tgcgacgatgacgttgacgacgtacacttcacagcacacatggcacacttcggcgttgat
gtgcacactgccaaaaagaccgccaaaacgatgggtgagctggagtacgattactcctcg
cagtttgacttcaacaagatcaccgaagctggcgcgtccttgactccatcttacggccca
ggccacactggcatcaagaatattggcaacagctgctacctcgcatccgttgtgcagtgc
ctcatgtcactggctccgttccagcgcttcttctttccagccaagtcaaccccgcatcag
gcacagtgcaccgcggatccgtacacctgtcaccactgccagacggagcgcgtggccgcc
ggtttgctctcgggtgagttcagccgggagggccacgacctcaccaatagcatctgcccc
cgtctctttaagaaggtgttcgccaaacagcaccctgagttctccaccggcgcccagcag
gatgcgcaggagtacctgctctacctactggaggaaatgcagcgatacgtgcgccccaac
gtcaacggcagtgcaggcgccggtggtgcacagcagccggtgcacccgtctgagattatg
gagatggtgatggaacatcgtatagagtgcagcaaatgccatcgagtgcgctacacatac
gagaaggacaagtgcctatccttgccgattccgatcgatccaatggtggcctcgacagac
gcggccgccacaagcgaggcagaggtgctcgaggtagaggtggatgcgatacgacccagg
tgctctctggaggactgcctgcgagcggccaccttgccaagtagcatccagtgccggtgt
gaggtgtgcggtgaatcggtcacgtactccactgtcacccgtctcgccagcttcccagat
gtgctgccagtgtgcatccgccgtacgtactttgacatagccacccacaacacaaagaag
atggatgtgtacgtggaggtgccgcaggagctcgagctggaggcgtaccgcggcattggg
ctgcaaccaggtgaggtgcctatgcctgcgtcgtcggctacctctgcagaagggcctagg
gcagatgcccacgtagccgctccgctgcaggaagtagatgaggtggcgctggtttctgtg
gtcagcatgggtatcgacatagacgtcgcgcgctacgcccttattcagacaaatatgaac
attgagcgcgccatagactacatattcagccatccacacatcgctgatgatgtcaaggcc
gccccaccgttgcactctgaggagcagcagctgactccaactcgcgcagctaccgcagtg
agcgttccaaagtcggccactgatgggaccgcctcgtacgagctcacagcgatgatcagt
cacatgggcgcgagtgcacggacagggcactacgtttgccacatcaaggatgccgcgaca
ggcaagtggctcctcttcaacgatgagaaggtgggtgagtcgcagaacccacccttctct
ctagccgcgctgtacttctttcaacgcaagacgtaa

DBGET integrated database retrieval system