KEGG   Leishmania braziliensis: LBRM_29_2280Help
Entry
LBRM_29_2280      CDS       T01113                                 

Definition
enoyl-CoA hydratase/isomerase-like protein
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
lbz  Leishmania braziliensis
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Class
Metabolism; Overview; Carbon metabolism [PATH:lbz01200]
Metabolism; Overview; Fatty acid metabolism [PATH:lbz01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:lbz00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:lbz00650]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:lbz00062]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:lbz00071]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:lbz00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:lbz00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:lbz00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:lbz00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
29:complement(949636..950439)
Genome map
AA seq 267 aa AA seqDB search
MYRYSRLIRCAAQPVVKTLQVGHVVTLTINRPSQLNALNRAVSESLMENLEKYDKDTSCS
VFIITGEGRAFVAGADIKSMKDRTFSEGVQSNDFSALTRMNTISKPIIAAVNGFALGGGC
ELAMSCDIIIASEGAKFGQPEIKLATIPGLGGTQRLTRMIGKARAMEWVLLGNTYTAAEA
ERAGLVSCVVKHEELMPTAMKMANTIASYSQVAVKLAKMAVNQSQETSLAAGLAYESMIF
NSTFATHDRKEGMTAFVEKRAPQFRNK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgctactctcgcttgattcgctgcgccgcgcagcctgtggtgaagacgcttcaa
gttggtcacgtggtcacgttaacgatcaatcgtccttcccaactcaatgccctcaacagg
gccgtgtcggagagcctcatggaaaacttggaaaagtacgacaaggacacctcgtgttcc
gtcttcatcatcacaggcgagggtcgcgcgttcgtcgcaggggccgacatcaaatctatg
aaggatcgcaccttttccgagggcgtccagtcaaacgacttctcagcattgacccgcatg
aacaccattagcaagcctatcattgcggcagtcaatgggttcgctctgggtggagggtgt
gagcttgccatgtcgtgtgacatcattatcgccagcgagggggcgaagttcggacagccc
gagattaaattggctaccattcccggactgggcggcacgcaacgtctgacacgcatgatt
ggtaaggctcgtgcgatggagtgggtactcttgggcaacacgtacacggcggccgaggca
gagcgagcggggctcgtgtcgtgcgtggttaaacacgaggagctgatgccaaccgctatg
aagatggcgaatacgatcgcaagctacagccaggttgctgtgaagctggccaaaatggct
gtgaaccagtcgcaggagacatcactcgcggctggcttggcatacgagtctatgattttc
aattctaccttcgctacccacgacaggaaggagggcatgactgcgtttgtggaaaagcgc
gcacctcagttccgaaacaagtaa

DBGET integrated database retrieval system