KEGG   Leishmania braziliensis: LBRM_30_0410Help
Entry
LBRM_30_0410      CDS       T01113                                 

Definition
putative mitogen-activated protein kinase
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
lbz  Leishmania braziliensis
Pathway
Leishmaniasis
Brite
KEGG Orthology (KO) [BR:lbz00001]
 Human Diseases
  Infectious diseases
   05140 Leishmaniasis
    LBRM_30_0410
Enzymes [BR:lbz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     LBRM_30_0410
Protein kinases [BR:lbz01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   LBRM_30_0410
Exosome [BR:lbz04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LBRM_30_0410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
30:complement(129708..130940)
Genome map
AA seq 410 aa AA seqDB search
MMLTKVEGPNAAGNKVYVFGVNDYRLEVPERYNVQHFVGRGAYGFVCSAVDAVTNEPVAI
KKVTHLFDDAVDAKRVLREVKLLAYLNHPNILSLKDLFKSPDPVDTYNELYVVTDLMESD
MDAILRSPRIRLAAGHGQYFTLQLLCALQYTHSAHVLHRDLKPGNLLTDSECNLKLGDFG
LARGVGHDDTMTQYVFTRWYRPPELLLVCKHCSYSADMWAVGCLAAEMFTGKPLFPGKDY
INQINLIVELLGIPDLARDLPPSTSQEAVHYLSSLPPIKGKTLEEYAPELRRRFDEATFF
DGFDTELEEAIAAEGATIARPQPRPPEDYYAEFVDFIFGLLCYNPEKRRMAKESIAHAWL
SDVRGPQENIGGCEAERVYCWDAEGTAFTIPQLRQLFVEEIEKFTSTRGH
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgatgctcaccaaggtagagggtcctaatgcggccggcaacaaggtttacgtctttggt
gtgaacgactaccgcctggaggtgccggagcgctacaacgttcagcacttcgttggacgt
ggtgcgtacggctttgtttgcagcgccgtggacgcggtgaccaacgagccagtggcgatc
aagaaggtgacacacctcttcgacgacgctgtcgatgcaaagcgtgtcttgcgggaggtg
aagctgctcgcctatctcaaccacccaaatatcctctctctcaaggacctcttcaagtcc
ccggacccggtggacacgtacaacgaactctacgttgttaccgacttgatggagtcggac
atggacgcaatcctgcgctccccgcgcatccgtctcgccgccgggcacggccagtacttc
actcttcagctgttgtgcgcactgcagtacactcacagtgcccacgtgcttcaccgtgac
ctgaagccggggaatctgttgacagactcggagtgcaaccttaagctgggcgactttggc
ctcgcgcgcggtgtcggacacgacgacaccatgacgcagtacgttttcacgcgatggtat
cggccaccagagttgctgctggtgtgtaagcactgcagctacagcgctgatatgtgggct
gtcggatgcctcgcagcagagatgttcactggcaagccgctcttccctggcaaggactac
atcaaccagatcaatttaatagtggagctgctgggcataccagaccttgcacgtgacctg
ccgccgagcacgtcgcaggaggcggtgcactacctctcctccctgccccctatcaagggg
aagacgctggaggagtacgcccctgagctgcggcgccgcttcgacgaggctacctttttc
gatggcttcgacacagagctggaggaggctatcgccgctgagggcgccactatcgcccgg
ccccagccgcgcccgccggaggattactacgccgagttcgtcgacttcatctttggactg
ctctgttacaaccccgagaagcggcgcatggcgaaagagtccatagctcatgcatggctg
tcggacgtgcgcggccctcaggaaaacattggcggctgcgaggcggagcgagtatactgt
tgggatgccgagggcactgccttcaccatcccacaactccgccagctgttcgtagaggag
atcgaaaaatttacgtctacccgcggccactga

DBGET integrated database retrieval system