KEGG   Leishmania braziliensis: LBRM_30_0410Help
Entry
LBRM_30_0410      CDS       T01113                                 

Definition
(RefSeq) putative mitogen-activated protein kinase
Organism
lbz  Leishmania braziliensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
30:complement(129708..130940)
Genome map
AA seq 410 aa AA seqDB search
MMLTKVEGPNAAGNKVYVFGVNDYRLEVPERYNVQHFVGRGAYGFVCSAVDAVTNEPVAI
KKVTHLFDDAVDAKRVLREVKLLAYLNHPNILSLKDLFKSPDPVDTYNELYVVTDLMESD
MDAILRSPRIRLAAGHGQYFTLQLLCALQYTHSAHVLHRDLKPGNLLTDSECNLKLGDFG
LARGVGHDDTMTQYVFTRWYRPPELLLVCKHCSYSADMWAVGCLAAEMFTGKPLFPGKDY
INQINLIVELLGIPDLARDLPPSTSQEAVHYLSSLPPIKGKTLEEYAPELRRRFDEATFF
DGFDTELEEAIAAEGATIARPQPRPPEDYYAEFVDFIFGLLCYNPEKRRMAKESIAHAWL
SDVRGPQENIGGCEAERVYCWDAEGTAFTIPQLRQLFVEEIEKFTSTRGH
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgatgctcaccaaggtagagggtcctaatgcggccggcaacaaggtttacgtctttggt
gtgaacgactaccgcctggaggtgccggagcgctacaacgttcagcacttcgttggacgt
ggtgcgtacggctttgtttgcagcgccgtggacgcggtgaccaacgagccagtggcgatc
aagaaggtgacacacctcttcgacgacgctgtcgatgcaaagcgtgtcttgcgggaggtg
aagctgctcgcctatctcaaccacccaaatatcctctctctcaaggacctcttcaagtcc
ccggacccggtggacacgtacaacgaactctacgttgttaccgacttgatggagtcggac
atggacgcaatcctgcgctccccgcgcatccgtctcgccgccgggcacggccagtacttc
actcttcagctgttgtgcgcactgcagtacactcacagtgcccacgtgcttcaccgtgac
ctgaagccggggaatctgttgacagactcggagtgcaaccttaagctgggcgactttggc
ctcgcgcgcggtgtcggacacgacgacaccatgacgcagtacgttttcacgcgatggtat
cggccaccagagttgctgctggtgtgtaagcactgcagctacagcgctgatatgtgggct
gtcggatgcctcgcagcagagatgttcactggcaagccgctcttccctggcaaggactac
atcaaccagatcaatttaatagtggagctgctgggcataccagaccttgcacgtgacctg
ccgccgagcacgtcgcaggaggcggtgcactacctctcctccctgccccctatcaagggg
aagacgctggaggagtacgcccctgagctgcggcgccgcttcgacgaggctacctttttc
gatggcttcgacacagagctggaggaggctatcgccgctgagggcgccactatcgcccgg
ccccagccgcgcccgccggaggattactacgccgagttcgtcgacttcatctttggactg
ctctgttacaaccccgagaagcggcgcatggcgaaagagtccatagctcatgcatggctg
tcggacgtgcgcggccctcaggaaaacattggcggctgcgaggcggagcgagtatactgt
tgggatgccgagggcactgccttcaccatcccacaactccgccagctgttcgtagaggag
atcgaaaaatttacgtctacccgcggccactga

DBGET integrated database retrieval system