KEGG   Leishmania braziliensis: LBRM_31_0140Help
Entry
LBRM_31_0140      CDS       T01113                                 

Definition
putative ubiquitin hydrolase
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
lbz  Leishmania braziliensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
31:complement(37777..39276)
Genome map
AA seq 499 aa AA seqDB search
MQRRTATHRSSSSPPHRSPAYPSSHHPLSQSFHHRLLTLSLMLAEIKVKWGKEDLTMEVD
LGSTVGALKEALKAKTGVPVEKQKLMGLKPATSKDDATLSAAGLAPGKTVMLIGSAESAV
AVPTVQAAAGEANKTGGFTETTTTSNGLRNIANTCYLNSALQMLRTIPEIREVLEAYRGD
NALLRQLSAVLQSLESTKEAVMPLQLWTTLVQTNPTFGERDEHGGFMQQDSQEVLNVLLQ
AVNSVLPEKYAHLFEGKMHQTLTCVDDPTDKGKESEVPFTMLSCNITGEVQTLEAGLEHA
FDERFTAPCEALQKDAAQFTRVSKLSEAPEYVFVHLVRFSWRVDIQKKAKILKPITFPFI
LDTAIVSTEALKASEKPVREILQERRDKELERRRRPRAERESSPADTPEQEKVPLILKNE
SGYYELCGVISHKGRSADGGHYVYWGRKADAWLVYDDENVAAVSKEDVRRLRGAGEAHIA
YVLLYRSRCPLTRAPVIPL
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgcagagacgcaccgcaactcaccgctcctcttcatctcctccccatcgatcaccggca
tacccttcctcccaccacccacttagccagtcattccatcatcgtttacttacgctctct
ctcatgctggccgaaatcaaagtaaaatgggggaaggaggacctcacgatggaggtggac
ctcggcagcacggtgggcgccctcaaggaggcgctcaaagcgaaaaccggagtgccggtg
gagaagcagaaactcatgggccttaagcccgccacgagcaaagatgacgctacactgagc
gccgctggcctcgcgcctggcaagacggtcatgttgattgggtcagcagagagcgctgtg
gcggtgcccacagtacaggcggccgctggagaggcgaacaagaccggcggcttcaccgag
actacgaccacctcgaatggtttgagaaatatcgccaacacgtgctacctgaactcggcg
ctgcagatgctgcgcaccattccggagattcgcgaagtgctcgaggcgtaccgtggcgac
aacgcacttctgcgccagctcagtgccgtgctgcagtcgttagagagcaccaaggaggcg
gtgatgccgctgcagctctggacgacgctggtgcagaccaatccaacgtttggtgagcgc
gacgagcatggcggtttcatgcagcaggactcgcaggaggtgctcaacgtgctgctccag
gctgtaaactctgttctacccgagaagtacgcgcatctctttgaaggcaagatgcaccag
accctcacctgtgttgacgacccgactgacaagggcaaggagtccgaggtgcccttcacg
atgctgtcctgcaacatcacgggcgaggtgcagacgctggaggcggggctcgagcatgcc
ttcgacgagcgcttcactgcaccttgcgaggcactgcagaaggacgccgcccaattcact
cgcgtcagcaaactgagcgaagcgccggagtacgtctttgtgcacctggtccgcttctcc
tggcgcgtggacatccagaagaaggcgaagattctcaagcccatcacgttccccttcatc
ctcgacaccgccattgtctccaccgaagcgctcaaggcctcagagaaaccggtgcgcgag
attctccaagagcggcgcgacaaggagttggagcggcgccgccgccctcgagcggaaagg
gagtcgtcgccagcggacacaccggagcaggagaaggtgcccctcatcctcaagaacgag
agcggttactatgagctgtgcggcgtcatctcgcacaagggccgcagcgcagatggaggc
cactatgtgtattggggtaggaaggcagacgcgtggcttgtctacgacgacgagaacgtg
gcggctgtctcgaaggaggacgtgaggcggctgcgcggtgccggggaagcgcacatcgcc
tacgtcctgctctatcgcagtcgctgccccctcacacgagcgccggttattccgctttag

DBGET integrated database retrieval system