KEGG   Leishmania braziliensis: LBRM_31_0140Help
Entry
LBRM_31_0140      CDS       T01113                                 

Definition
putative ubiquitin hydrolase
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
lbz  Leishmania braziliensis
Brite
Enzymes [BR:lbz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     LBRM_31_0140
Peptidases [BR:lbz01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   LBRM_31_0140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
31:complement(37777..39276)
Genome map
AA seq 499 aa AA seqDB search
MQRRTATHRSSSSPPHRSPAYPSSHHPLSQSFHHRLLTLSLMLAEIKVKWGKEDLTMEVD
LGSTVGALKEALKAKTGVPVEKQKLMGLKPATSKDDATLSAAGLAPGKTVMLIGSAESAV
AVPTVQAAAGEANKTGGFTETTTTSNGLRNIANTCYLNSALQMLRTIPEIREVLEAYRGD
NALLRQLSAVLQSLESTKEAVMPLQLWTTLVQTNPTFGERDEHGGFMQQDSQEVLNVLLQ
AVNSVLPEKYAHLFEGKMHQTLTCVDDPTDKGKESEVPFTMLSCNITGEVQTLEAGLEHA
FDERFTAPCEALQKDAAQFTRVSKLSEAPEYVFVHLVRFSWRVDIQKKAKILKPITFPFI
LDTAIVSTEALKASEKPVREILQERRDKELERRRRPRAERESSPADTPEQEKVPLILKNE
SGYYELCGVISHKGRSADGGHYVYWGRKADAWLVYDDENVAAVSKEDVRRLRGAGEAHIA
YVLLYRSRCPLTRAPVIPL
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgcagagacgcaccgcaactcaccgctcctcttcatctcctccccatcgatcaccggca
tacccttcctcccaccacccacttagccagtcattccatcatcgtttacttacgctctct
ctcatgctggccgaaatcaaagtaaaatgggggaaggaggacctcacgatggaggtggac
ctcggcagcacggtgggcgccctcaaggaggcgctcaaagcgaaaaccggagtgccggtg
gagaagcagaaactcatgggccttaagcccgccacgagcaaagatgacgctacactgagc
gccgctggcctcgcgcctggcaagacggtcatgttgattgggtcagcagagagcgctgtg
gcggtgcccacagtacaggcggccgctggagaggcgaacaagaccggcggcttcaccgag
actacgaccacctcgaatggtttgagaaatatcgccaacacgtgctacctgaactcggcg
ctgcagatgctgcgcaccattccggagattcgcgaagtgctcgaggcgtaccgtggcgac
aacgcacttctgcgccagctcagtgccgtgctgcagtcgttagagagcaccaaggaggcg
gtgatgccgctgcagctctggacgacgctggtgcagaccaatccaacgtttggtgagcgc
gacgagcatggcggtttcatgcagcaggactcgcaggaggtgctcaacgtgctgctccag
gctgtaaactctgttctacccgagaagtacgcgcatctctttgaaggcaagatgcaccag
accctcacctgtgttgacgacccgactgacaagggcaaggagtccgaggtgcccttcacg
atgctgtcctgcaacatcacgggcgaggtgcagacgctggaggcggggctcgagcatgcc
ttcgacgagcgcttcactgcaccttgcgaggcactgcagaaggacgccgcccaattcact
cgcgtcagcaaactgagcgaagcgccggagtacgtctttgtgcacctggtccgcttctcc
tggcgcgtggacatccagaagaaggcgaagattctcaagcccatcacgttccccttcatc
ctcgacaccgccattgtctccaccgaagcgctcaaggcctcagagaaaccggtgcgcgag
attctccaagagcggcgcgacaaggagttggagcggcgccgccgccctcgagcggaaagg
gagtcgtcgccagcggacacaccggagcaggagaaggtgcccctcatcctcaagaacgag
agcggttactatgagctgtgcggcgtcatctcgcacaagggccgcagcgcagatggaggc
cactatgtgtattggggtaggaaggcagacgcgtggcttgtctacgacgacgagaacgtg
gcggctgtctcgaaggaggacgtgaggcggctgcgcggtgccggggaagcgcacatcgcc
tacgtcctgctctatcgcagtcgctgccccctcacacgagcgccggttattccgctttag

DBGET integrated database retrieval system