KEGG   Leishmania braziliensis: LBRM_31_3340Help
Entry
LBRM_31_3340      CDS       T01113                                 

Definition
putative acetyl-CoA carboxylase
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
lbz  Leishmania braziliensis
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:lbz01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:lbz00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:lbz00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:lbz00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
31:complement(1459842..1466348)
Genome map
AA seq 2168 aa AA seqDB search
MKVEQGRDSPVGFQFESMQQLCSSLGGTMPIKRLLVANNGLAAVKGMDSIRSWMYDHMGD
SEAVQFVVMATPEDLKGNAEFISLADKHILVPGGMNSNNYASVDVIMQTALQNMCDAIYP
GWGHASENPALPRECLKSKRVTFLGPSEDSMFALGDKIASTIVAQSNGVPTVPWSGDSLR
IAPNTFGVDPVTYDRAYVTSPEECEEVCQRIGFPVMIKASEGGGGKGIRCCTCEKDVKNL
FFAVSEEVKGCHIFVMRMLGNVRHLEVQLLADCHGNCIAVGTRDCSVQRRHQKVIEEGPV
FGVDPAVIMAMESAAIQLARAVRYCGVGTVEYMYDKETHEFYFLELNPRIQVEHPVSEMI
SGVNLPAALFCVGMGIPLDRIPEVRVFYGEEAYGVTPIDFTARHSLPPKCHTIAVRVTAE
DTDEGFRPTSGKVDEIAFKNSRECWGYFSVGSSGEIHQFSDSQFGHIFSSGETREEARRG
MVLALRHLVVRGEIRTSTPYVMELLETPAFRDCDVSTAWLDKLIAKKAAEAPAHPRSIHS
ALIAASIYRNMRSMQEHKNKYISFLAAGHVPSVEYLSNLHTESYVSCSEKYTLSAGMVSL
NEYAISLNDSTVIVPYRILKSGALQLTIGDKTLVAYVAEEPSSLRITIGGKVTNFSGDVD
PTKIMASVPGRLVRYVIANDGHVNEGDTFAEVEVMKMILPLRARTTGTLHHHAVPGSTIA
MGSLLGKITPEDPSKVARPREIKDPWPTELLLARQYERPDGVTRARRAAESLWVLVNGFH
FKGVSIEERVHKAFAGLASLGLSSVTLKAIHLPFIPASMCEETKEHPLTPSDKYRVIIDT
IVDRYVTVEQAFDGHSRQEAIEGLRSTLNDNEAVFEVDFAHNQECHHYVMRSLLKYLESN
MLLLKSLKGTLSKLVTLKSFAYGSLLLQARYLLRMCALPSFTERKAQFAEALESGSLLNL
IASSFGYDLLCSIMFDRQMEHLVQICLELFIRREYFGESEIKDLDIFKEGSNWYASYSFN
PIEDADALCMGDEQAVESPRASGGRGICAMLPDEKLFKSTLASSFCDVLLNYSDDIVIAT
VFFSVSRESTQPDVACMCRLLLEENAIALQRFKNLETIYFVTHGMPDGPHFFTFRAKTSF
QEDTLLRNVLPQSARRLELDRLSNYEVSMHPTPYKDVHVFMAIPKKVGASALENRMFARV
ALAPHDMGMSPWTEATDVDVGHMLAKCLAALQVARDDSTVKFPDSNHVFVKLIELTFDVR
SLKSLLAAVASSYQGKLIELGVRDVELSFHVKVPSGLIPMRVIANSPSGYGVSMRVFYES
LVNGQVQLHRAEASEDVDYSSMSCHSELLVVVNPRSPTSALFRESSQLMRAVSKLEDLRE
MLPSEKELQSAVSMLSEPEEACDRVVTLGPYPQLSTREVKRLQARRADTTYVHDWPAVLN
LIVRRDWMKLRRARDLPCTSIPKDPLRATELFLSEDGESLSTNNSCALPCGMVVWMIEYA
PPHYFKMKSEVAQTRRIVVVANDITFQSGSFAVPEDRVFKAASVLARAQGVPFVYISANS
GARLGISTEVKKRFLVEFTDKNDIAYLYLTTSDYEELRAKGIRIEVEPLEVNGETRHILK
GVVGGPTEYLGVENLSGSGLAAGEMSKNYNEVPTISLVSGRSVGIGAYLNRLGRRIIQTN
DSPLILTGASALNRLLGKDVYMGNSQLGGKQIMVPNGVTHWCTRHDYSSARVLLQWLDYV
PATLHPLRCTPRRLLWNAADPIDRDVTFSPTPNTQYDPRFLVTGQLGQTGLFDRGSWMET
LEGWARTVVVGRATLGGIPCGVILVETRLTKKFSPADPADPTSTSSFITQAGQVWFPDSA
RKTADALDDFHHERLPCFILANWRGFSGGMRDMFDEVLKFGAAIVDNLRVYTAPVFIYIP
PGGELRGGAWVVVDPTVNHNGVVEMYCDPSSRGGILEPSGVVEIKFRDNDVLALIRRSRP
DLATMEPKLACKIEKGLLQQYRDVAVRFADLHDTSVRMKATGVMRDTVPWKDSRRHFYHK
LQRKLKELEVANDMLERDIVDSLAEGVRKVENRYTEEHPNGPAWGTADQQQLKWLQGLDG
TWVGESNGHTTLSSRGWVKEVERLLTQHGGEASSMESALAELFENPVIAKAAKEVLNSTS
VFPSSTTA
NT seq 6507 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtggagcagggaagggactcccccgtgggcttccagttcgagtccatgcagcag
ctgtgcagctcacttggggggacgatgccaatcaagcgccttctcgttgccaacaacgga
ctcgctgctgtgaaggggatggactcgattcgctcgtggatgtacgaccacatgggcgac
tctgaggcggtgcagttcgtggtgatggccaccccagaggacctgaaggggaatgccgag
ttcatctcgctcgcagacaagcacatccttgttcctggcggcatgaacagcaacaactac
gcaagcgtggacgtgattatgcagacggcgctgcagaacatgtgcgacgccatctatccc
ggctggggccacgcctccgagaacccggctctgccgcgcgagtgcctcaagtcgaagcgc
gttacctttctcggtccgtccgaggactccatgtttgcgttgggagacaagatcgcttca
accattgtggcgcagtcgaacggtgtaccgacggtgccgtggagcggtgacagcctccgc
atcgctccaaacaccttcggtgtggaccccgtcacgtacgacagggcatacgtgacgtcg
ccggaggaatgcgaggaggtgtgccagcgcatcggcttccctgtaatgatcaaagcgtcg
gagggtggtggtggcaagggcatccgctgctgcacgtgtgagaaggacgtcaaaaatttg
ttctttgccgtctcggaggaagtgaaaggctgccacatctttgtgatgcgcatgctgggg
aacgtgcgccacctggaggtgcagctgctggccgactgtcacggcaactgcatcgccgtg
ggcacgcgtgactgcagtgtgcagcggcgccatcaaaaggtcatcgaggaaggccccgtc
ttcggggtcgatccggccgtcatcatggcgatggagagcgcggcgattcagctcgctcgc
gcggtgaggtactgcggtgttggcacggtggaatacatgtacgacaaggagacgcacgaa
ttttactttctggagctgaacccgcgcatccaggtcgagcaccccgtgtcggagatgatc
tccggcgtgaatctgcctgccgccctgttttgcgtcggcatgggcattccgctcgaccgc
attccggaggtgcgcgtgttctacggtgaggaggcgtacggcgtcacccccatcgacttc
acggcccgccacagccttccgccaaagtgtcacacgattgccgtgcgcgtgaccgccgag
gatacggatgagggcttccggccgacctccggaaaggtggatgagatcgccttcaagaac
agcagagagtgctggggctacttctccgtcggctccagcggcgagattcaccagttttcc
gactcgcagttcgggcacatcttctcctccggcgagacccgcgaggaggcgcgccgcggg
atggtgctggcgctccgccaccttgtcgtccgcggcgaaattcgcacgtcgacaccgtac
gtcatggagctgctggagacgccggccttccgcgactgcgatgtgagcacggcttggctg
gataagttgatcgcaaagaaggctgctgaagcgccggcgcacccccgcagtatccactcc
gcgctgatcgccgctagcatctaccgaaacatgcgttccatgcaggaacacaagaacaag
tacatcagcttcctcgccgccggccacgtgccctccgtcgagtacctttccaacctccac
accgagtcctacgtgagctgctcggagaagtacacactgagcgccggaatggtgagcctc
aacgagtacgccatctcgttgaacgacagcaccgtcattgtgccctaccgcatcctcaag
tccggtgccctgcagctgaccatcggcgacaagacactggtcgcctacgttgcggaagag
ccgagcagcctgcgcatcaccatcgggggcaaagtgacgaacttctccggcgacgttgac
ccgacgaagattatggccagcgtccccggccgcctggtgcgctacgtcattgcgaatgac
ggccacgtcaatgagggcgacacgtttgccgaggtggaggtaatgaagatgattctgccg
ctgcgggcgagaacgactggtacgttgcaccaccacgccgtgccaggtagcaccatcgct
atgggctcgctgctgggcaagatcacccccgaggacccgagcaaggttgcgcggccaagg
gagatcaaagacccctggccgacggagctccttctggcccgtcagtacgagcggccagac
ggcgtcacacgcgcgcgccgcgccgcagagtcgctgtgggtgctcgtcaacggcttccac
ttcaagggggtgtctatcgaggagcgggtgcacaaagcgtttgccggcctcgcctcgctg
ggcctctcatccgtcacgctcaaggcgattcacctgcctttcatcccagcgtcgatgtgt
gaggaaacgaaggagcacccgctgacaccgagcgataagtaccgcgtcattatcgacacc
atcgtggaccggtatgtgactgtggagcaggcctttgacggacacagccggcaggaggcg
attgaggggctgcgcagcaccctcaacgacaacgaggctgtcttcgaggtggactttgcg
cacaaccaggaatgccaccactacgtgatgcgcagcttgctgaagtacctcgagagcaac
atgctgcttctcaagtcgctgaaggggacgctgtcgaagctggtcaccctcaagtccttc
gcgtatgggtcattattgctgcaggcgcgctatctcctccgtatgtgcgccctgccgtcc
ttcacagagcgcaaggcgcagttcgcggaggcgctggagagtggtagtctgctcaacctc
atcgccagtagcttcggctacgacctcctctgctccataatgtttgacaggcagatggag
cacctcgtgcagatatgcctcgaactgttcattcgccgtgagtactttggcgagagcgaa
atcaaggacttggatattttcaaggagggctctaactggtatgccagctacagctttaac
cccatcgaggacgcggatgcgctgtgcatgggcgacgagcaggcagtggaatcgccgaga
gccagcggtgggcggggcatctgcgccatgttgcccgatgagaagttgtttaagtcgacg
ctggcctcgtcgttttgcgatgtgctgttgaactacagcgatgacatcgtcattgcaacc
gttttcttctccgtgtcgcgggagtcgacgcagccagacgtggcgtgtatgtgccgcctt
ttgctggaggagaacgcgatcgccttacagagattcaaaaacctcgagacgatctacttt
gtgacgcacgggatgccggacgggccgcacttcttcacgttccgggcgaagacgagcttt
caggaggacacgctactgcgtaacgtgctgccacagtcggcgcgtcggctggagctcgac
cggctgtccaactacgaggtgagcatgcacccgacgccctacaaggatgtacacgtcttc
atggcgatccctaagaaggttggagcatccgcgctggagaaccgcatgttcgcgcgcgtg
gcgctagcgccgcacgacatgggcatgtctccctggacagaggcgaccgatgtggatgtg
ggccatatgctggcaaagtgcctagcagcgcttcaggtagcccgtgacgactcgacagtg
aagtttccggatagcaatcatgtgttcgtgaagctgattgagctgaccttcgacgtccgc
tcgcttaagtccctactggcggcagtggccagctcctaccaggggaagctgatagagctg
ggcgtgcgggatgtcgagttaagtttccatgtgaaggtgccatcgggtctcattccgatg
cgtgtcatcgccaacagcccgtctggctacggcgtgtcgatgcgcgtcttctatgagtca
ctggtgaacggccaggtacaactgcaccgcgccgaggcgtctgaggatgtcgactactca
tctatgagctgccactccgagctcctggtggtggtgaaccccagaagccccacatcggct
ttgtttcgcgagtcctcgcagctaatgcgcgccgtgtcgaagctggaagacctgcgcgag
atgctgccttctgagaaggagctccagagtgctgtcagcatgttgtcagagccagaggag
gcgtgcgaccgcgtcgtcactctcgggccgtacccgcaattgagcacgcgtgaggtgaag
cgcctccaggcacgccgcgcggatacgacgtacgtgcatgactggcccgccgtgctgaat
ctgatcgtacgcagggattggatgaagctgcgccgcgcgcgtgatctgccgtgcacctct
atcccgaaggacccattgcgcgcgacagagctcttcctcagcgaggacggtgagtcgctg
tcgacgaacaattcatgcgcgttgccatgcggcatggtggtgtggatgatcgagtacgca
ccgccgcactacttcaaaatgaagtcggaggtggcacagacgcgccgtatcgtggtcgtc
gctaatgatatcacctttcagtcggggtcctttgctgttccggaggaccgcgtcttcaag
gctgcctcggtgctcgcccgtgcccagggcgtgccgtttgtgtacatcagcgccaacagc
ggcgcacgcctcggcatcagcaccgaggtgaagaagaggtttctcgtcgagttcacggac
aagaacgacatcgcctacctgtacctcaccacgagcgactacgaggagctgagggcaaag
gggattcggatagaagtagagccgcttgaggtgaacggtgagacccggcacatactcaag
ggcgtggtgggcggtccgacggagtacctcggggtggaaaacctgagcgggtcaggcctc
gcggcgggtgagatgtcaaagaactacaacgaggtcccaacaatcagccttgtctcgggc
cgaagcgtcggcatcggtgcctacctcaaccggcttggtcgccgcatcattcagacgaac
gactcgcctctaatcctcaccggcgccagtgccctcaaccgactactcggcaaggacgtg
tacatgggaaacagccagctcggcggcaagcaaattatggtcccgaatggcgtgacgcac
tggtgcacacgccacgactacagctccgcccgcgtgttgctgcagtggctggactacgtg
ccagcaactctgcaccctctgcgctgcaccccgcgccgcttgctctggaacgctgccgat
ccgatcgatcgcgacgtgactttctccccgacgccgaacacacagtacgacccgcgcttc
ctcgtgacgggacagctcggtcagacgggcctgttcgaccgcggctcgtggatggagacg
ctggaagggtgggcacgcacggtagtggtgggtcgtgccacgcttggcggcattccgtgc
ggtgttatccttgttgagacgcgcctgacgaagaagttttccccggccgatccggctgat
ccgacttcgacgtcttcctttatcactcaggcggggcaggtgtggtttccagactcggcg
cgcaagacagccgacgctctcgacgacttccaccacgagcggctaccgtgcttcatcctg
gcgaactggcgcggcttctccggtgggatgcgcgacatgtttgatgaggtgctgaagttt
ggcgccgccatcgttgacaaccttcgcgtttacaccgcgccggttttcatctacatcccg
ccagggggcgagctgcgcggtggagcctgggtggttgtggaccccaccgtcaaccacaat
ggcgttgtcgagatgtactgtgacccctcctcgcgcggtggcatcctcgagccgtccggc
gtggtggagatcaaattccgcgacaacgacgtgctggcgctgattcggcgaagtaggccg
gatctcgcgacgatggagccgaagctggcctgtaaaatcgaaaaaggcctgctgcagcag
taccgcgacgtcgcggtgcggttcgccgatttgcatgacacaagcgtgcggatgaaggcg
accggagtgatgcgcgacaccgtgccgtggaaggatagtcgtcgccacttctaccacaag
ctgcagcgcaagctgaaggagctggaggtggcgaatgacatgctcgaacgcgacatcgtc
gactccctcgcggagggcgtgcgaaaggtcgagaatcgctacacggaggagcacccgaac
gggccagcatggggaacggccgatcagcagcaactgaagtggctgcaggggctcgatggc
acgtgggtcggggagagcaacggccacacaactctaagcagcaggggctgggtgaaggag
gtggagcgcttgctcactcagcacggtggtgaggcgagctcgatggaaagtgcgctggcg
gagctttttgagaacccggtcattgctaaggccgcgaaggaggtcttgaactccacctca
gtctttccgtctagcacaactgcatag

DBGET integrated database retrieval system