KEGG   Leishmania braziliensis: LBRM_32_0570Help
Entry
LBRM_32_0570      CDS       T01113                                 

Definition
putative profilin
Orthology
K05759  
profilin
Organism
lbz  Leishmania braziliensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
32:complement(206470..206922)
Genome map
AA seq 150 aa AA seqDB search
MSWQAYVDDSLIGSGNMHSAAIIGAADGSYWAYGGSYIPQPEEVKHIQKCLADFSLVQSS
GVTIYGVKFFGLQCGTDGDTKHIFFKKGAAGGCIYTTKQAFIVAVYGDPGDTSSLQQALA
KNASHAAAVNPADCNTTVKRIADYLVKLGY
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcaggcgtacgttgatgacagccttatcggcagcggtaacatgcacagcgcc
gccattattggagctgctgacggcagctactgggcgtacggcggtagctacattccgcag
ccggaagaggtgaaacatattcagaagtgcttggccgacttctcgcttgtgcagtcctct
ggtgtcactatttacggtgtcaagttctttggcctccagtgcggcaccgatggcgacact
aagcacatcttcttcaagaagggtgcggctggcggatgcatttacactacgaagcaggca
ttcatcgttgccgtgtacggcgaccccggtgacacctcctcgctccagcaggctcttgcg
aagaacgcatctcacgcggccgccgtgaaccctgcggactgcaacacgacagtgaagcgc
attgcggattacctcgtcaagcttggctactaa

DBGET integrated database retrieval system