KEGG   Leishmania braziliensis: LBRM_32_1400Help
Entry
LBRM_32_1400      CDS       T01113                                 

Definition
putative ubiquitin hydrolase
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
lbz  Leishmania braziliensis
Brite
Enzymes [BR:lbz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     LBRM_32_1400
Peptidases [BR:lbz01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   LBRM_32_1400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
32:495684..496913
Genome map
AA seq 409 aa AA seqDB search
MNNNNFCFMNSILQVLIFIPSFAQLSVSASCDAQACQLCPTLATFGKWALQYWKPGFTRL
AMTAPMLMPRVPAGTKNSKSATPQSAAVPASQRVLDGSVQEDAQEFLQMLLERLHEELVS
LESVLEKVEASETATKSGTRPTTPSASTSTTIAGDGSDAPGNVTPSACHQKGWMIVKGKE
KLAVREHEDAQGQSKLLGSLFGGTLESYLQGKQRQRDRVSVVIERYYCLPVDVGFAPECT
IEQALEHTFTTERIYDSTHEKNLKKTLRLGHLPFILFLQLRRWAVTREGELVKLDNVVHI
KRMLLIPRTICGDETLDNTERTYRLLSVVCHRGDAVGCGHYVTYLVHHAATPAILKVQAS
EPGNKKAAIMRSPPDAATVILCNDANVSVCPAKNMEKETMYFLVYQKTG
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaacaacttctgcttcatgaactcgattctgcaggtgctcatattcattccg
tcctttgcgcaactgtctgtgtcagcgagctgtgatgcccaggcctgccaactgtgtccc
acattggcgacttttggaaagtgggcacttcagtactggaagcctggtttcacacggcta
gcaatgacagccccgatgttgatgccgcgcgtgcctgctggcaccaaaaacagtaagagc
gccacccctcagtccgccgcggtgcctgcctcgcagcgggttcttgatggctctgtgcag
gaggacgctcaggagtttcttcaaatgctgctggagcgtctgcatgaagagttggtgagc
ttggagagcgtcttggagaaggtggaggcatctgaaacggcaacaaagagcgggacaaga
ccgactactccttcggcctcgacgagcactacgattgccggtgatggaagcgatgctcct
ggcaatgtcaccccctcggcgtgtcatcagaagggctggatgattgtgaagggaaaggag
aagctggcagtgcgggagcatgaggacgcacaagggcaatcgaaactgctaggaagtctc
tttgggggcacgctggagagctacttgcaggggaagcaacgtcaacgcgaccgtgtgtca
gtagtcatcgagaggtactactgcctccccgtcgacgtgggctttgcaccagagtgcacg
attgagcaggctctcgagcacaccttcacgacagagcgcatctatgacagtacgcacgaa
aagaaccttaaaaagacgcttcgcctaggccacctgcccttcattctcttcctgcagctg
cgccgctgggccgtgacacgcgagggcgagcttgtaaagctcgacaacgttgtacacatc
aaacgaatgttgctgattccacgcaccatctgcggggatgaaacacttgacaacacagag
cgaacgtaccgtcttttgtccgttgtgtgccaccgtggcgacgccgttggctgcgggcac
tacgtcacttatttggtgcaccacgccgcgaccccagccatcctgaaggtgcaggcgagt
gagccggggaacaagaaggctgcaatcatgcgctcgccgcccgacgcggcgacggtgatt
ctctgcaatgacgccaatgtctctgtgtgcccagcaaagaacatggaaaaggagaccatg
tactttctcgtctaccagaagacaggttga

DBGET integrated database retrieval system