KEGG   Leishmania braziliensis: LBRM_32_3920Help
Entry
LBRM_32_3920      CDS       T01113                                 

Definition
putative 3-hydroxyisobutyryl-coenzyme A hydrolase
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
lbz  Leishmania braziliensis
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lbz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LBRM_32_3920
  Carbohydrate metabolism
   00640 Propanoate metabolism
    LBRM_32_3920
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LBRM_32_3920
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LBRM_32_3920
Enzymes [BR:lbz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     LBRM_32_3920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
32:1467486..1468613
Genome map
AA seq 375 aa AA seqDB search
MRHTAARCSAAVLCTDYPHARLITLNKPKSLNALDYDMTRELHRLYVTEPAPLSSLYILT
GAGTKAFCAGGDVIGLTTNTPPGCGRGFFYEEYQVDYKTSILPAGQVCLWDGYVLGGGVG
VSVGGTYRVASEKACLAMPEVAIGMFPDVGASWFLPRLSVPGLGLYMGLTGHRLRGADLV
HLGLATHFVPSAKMDDLKHALVSMSKAGDVEAALEKYATPTAQLPPCTIAHSFPSLAQYF
DITEDLTILSILDACKTHAHTDPLIKAAADLMPTFSPTAMTLTLEMLKRGAKLSTPVEAF
KMEYCVSQRVIAAHDFREGVRALLIDKEKGPKWQPATFAEVTAEAIDAYFRPTTADQLVW
DPVAPLPERALCDLT
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcatacagctgcgcgttgtagcgcggccgtgctctgcaccgactacccacatgca
cgcctcataaccctcaacaagccaaagtccctcaacgcgctagactatgacatgacacga
gagctgcaccgactgtacgtgacagagccggctcctctgtcgtccctgtacatcctcacc
ggtgccggcacgaaggctttttgcgccggtggcgatgtgattggcctcacgacgaacaca
ccgcccgggtgcggccgtggcttcttttacgaggagtatcaggtcgattacaagacgagc
atccttcctgctgggcaggtatgcctatgggatggctacgtactcggcggcggtgtgggc
gtatcggttgggggcacttatcgtgttgcgtcagaaaaggcatgccttgcgatgcctgag
gtggccataggcatgttccccgacgtaggggcgtcctggttcctgccgcgactgtcggtg
cctggactgggactctacatgggtctcactggtcaccgactccggggtgccgacctcgtg
cacctcggccttgcaacgcattttgtgccatctgctaagatggacgatctgaagcatgct
cttgtctcgatgtcgaaggcaggtgatgtggaggcggcattggagaagtacgcgacgccg
acggcgcagctgccaccctgcaccatcgctcattcgtttccttctctcgcccagtatttc
gacatcacagaggatttgaccatattgtccatcttggatgcgtgcaagacgcacgcgcac
acggatccgttgatcaaggcagcagcagacctcatgcccaccttttcaccgacagcgatg
acgctcacactggagatgctgaagcgcggtgcaaagctgagcacaccggtggaggcgttc
aagatggagtactgcgtttcccaacgggtcatcgcggcacacgactttcgcgaaggtgtc
cgagccctgctcattgataaggagaaggggccgaagtggcaaccggcaacttttgctgag
gtaacggcggaggccatcgatgcgtactttagacccaccacggccgaccagttggtctgg
gatccagtagcgccgctgccagagcgcgcattgtgtgatcttacctga

DBGET integrated database retrieval system