KEGG   Leishmania braziliensis: LBRM_33_1290Help
Entry
LBRM_33_1290      CDS       T01113                                 

Definition
putative guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
lbz  Leishmania braziliensis
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lbz00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LBRM_33_1290
Enzymes [BR:lbz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LBRM_33_1290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
33:446544..447155
Genome map
AA seq 203 aa AA seqDB search
MNKPLNALVVCGPSGVGKGTLLGRLIREYPNRFAYSVSHTTRKPRQGEVDGREYHFIDCE
SILKMRDNNEFLELCDVHGNLYGTSVAAVHAVQQEGKVCIIEIDVKGAQKLFDRTDKALN
AVYFFITAPKEELRKRIMKRGADNEAMLQRRLETAESEYKFLEENPDFFSVLLVNDELEA
AYAGLLAAINDQLRKHNMEKLTA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagcctctgaacgcgttggtggtgtgcggcccatctggtgtaggcaagggaacc
ctactgggccgccttatccgtgagtaccccaaccgcttcgcctactcggtgtcgcacaca
actcgtaaaccacgtcagggagaggtagatggccgtgagtatcacttcatagactgtgag
agcatcctcaagatgcgcgacaacaacgagttcctcgaactgtgcgacgtgcacggtaac
ctctacggcacgagcgtcgccgccgtgcacgccgtacagcaggaggggaaggtgtgcatc
atcgagatagatgtgaagggggcacagaaactgttcgaccgcaccgacaaggcgctgaac
gccgtgtacttcttcataacggctccaaaggaagagctgcgcaagcgcatcatgaagcgt
ggcgccgataatgaggcgatgctgcagcggcgtcttgagacagccgagtcagagtacaag
tttctcgaggagaatcccgacttcttctccgtgctgctggtgaatgatgagctggaggcg
gcgtacgctggtctcttggccgccatcaatgaccagctgaggaagcacaacatggagaaa
ctgactgcctag

DBGET integrated database retrieval system