KEGG   Leishmania braziliensis: LBRM_33_1650Help
Entry
LBRM_33_1650      CDS       T01113                                 

Gene name
MPK11
Definition
putative mitogen activated protein kinase
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
lbz  Leishmania braziliensis
Pathway
Leishmaniasis
Brite
KEGG Orthology (KO) [BR:lbz00001]
 Human Diseases
  Infectious diseases
   05140 Leishmaniasis
    LBRM_33_1650 (MPK11)
Enzymes [BR:lbz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     LBRM_33_1650 (MPK11)
Protein kinases [BR:lbz01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   LBRM_33_1650 (MPK11)
Exosome [BR:lbz04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LBRM_33_1650 (MPK11)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
33:575933..577159
Genome map
AA seq 408 aa AA seqDB search
MPATKSLAELQAEVCRLDDRYRLERIIGAGSYGIVIRARDIKSDNCLVAIKRVNKEIFDE
VVLAKRILREIKLLAHFNDENIIGLRNILTPEDPENFEHFYIVMDIMETDLKQVLRSGQE
LTEAHIQFFIYQVLRALHIIHSAGVIHRDITPANILVNTNCDLKICDFGLAKEENDQGEY
MTDYVTMRWYRAPELVMEGKDYSVQIDVWGIGCILGELLGSRPLFQGKDRVNQLDKIVDL
IGTPSDEDISSVGSAAAQKYLKKKGYRPRPDWRQRYPNASVQALDLLRRMLVFNPKQRIT
VLQAMRHPFLDQLHDDADDSITYTPFHFDEQKQKTVLDVKRAIYEESVKFHKAHQSSMQT
TSMNNTFNSISMPAPSVATEGEGRSAQQTIEKDIPESTTDGNFDRDQA
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgccggctaccaagtcactcgcagagctgcaggcggaggtctgccggctggacgaccgc
taccgtctggagcgcatcattggtgccggctcctatggtattgtgatccgcgcgcgtgac
atcaaaagcgacaactgccttgtcgccattaagcgcgtcaacaaggagatctttgatgag
gttgttttggcgaagcgcattctgcgcgagatcaagctattggcgcactttaatgacgag
aacataattggcctgcgcaacatcctcacccctgaggacccagagaactttgagcacttc
tacatcgtaatggacattatggaaaccgacctgaagcaggtgctgcgcagtggccaggag
ctgacggaggctcacattcagttcttcatctatcaggtgctgcgcgcgctacacatcatt
cacagcgccggtgtcatccaccgtgatattacgccggcaaacattttggtcaacacgaac
tgcgatttgaagatttgtgactttggcctggcgaaggaggaaaacgatcaaggcgagtac
atgacggactacgtgacgatgcgctggtatcgtgcgccggagttggtgatggagggaaag
gactactcagtgcagattgatgtgtggggtatcggctgcatccttggcgagctactcggc
tctcgtccgctcttccaggggaaagaccgcgtgaaccagttggacaagatagtcgatctg
atcggtacgccatccgacgaggacatcagctccgtaggctcggctgctgcgcagaagtac
ctcaagaagaaggggtaccgtccgcggcctgactggcgccagcgctacccaaatgcatct
gtccaggcgctcgatctgctgcgccgcatgctggtcttcaacccgaagcagcgaatcacg
gtgctgcaagcaatgcgtcacccgttcttggatcagctgcacgacgacgctgacgatagc
atcacctacacccccttccactttgacgagcagaagcagaagacagtactggatgtgaag
cgcgccatctacgaggagagcgtcaagtttcacaaggcgcaccagtcctcgatgcagaca
acgagcatgaacaataccttcaactccatcagtatgcccgcaccgagcgtggcgacagag
ggcgagggccgctcggcgcagcagacgattgagaaggacatccctgagagcacgacggac
ggcaactttgaccgtgatcaggcgtaa

DBGET integrated database retrieval system