KEGG   Leishmania braziliensis: LBRM_34_0970Help
Entry
LBRM_34_0970      CDS       T01113                                 

Definition
aldose 1-epimerase-like protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
lbz  Leishmania braziliensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lbz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBRM_34_0970
   00052 Galactose metabolism
    LBRM_34_0970
Enzymes [BR:lbz01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     LBRM_34_0970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
35:378057..378779
Genome map
AA seq 240 aa AA seqDB search
MENGFPGELVSKVTYSIERAKPNVLKTAYDSYIPETSPADATPVNIFNHAYWNLNGIPER
NGKRDAVWVQPQSVHNHWLRVPASRVAEADRMAIPTGEYLSVDGTPLDFRKGRVLKDGIR
DPALDRDPCGYDHPLAIDGWEKGKLMLHAEAKSPTTNICMKVYSTFPCMWVYTANNKPLP
ASGGPGQRYARWTGMGLEPQYFPDSANHYPKYPSCIVRRGENRFTEVILNEFTVSGSSKV
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggagaacggcttccccggtgagctggtgagcaaggtcacctactcaattgagcgggca
aagccaaacgtgctcaagaccgcctacgactcctacatcccggagacgagcccggcagat
gccaccccggtcaacatattcaaccacgcctactggaacctcaacggtatcccagagcgc
aacggcaaacgcgacgccgtgtgggtgcagccgcagagcgtgcacaaccactggctccgc
gtgccggcaagccgggtggccgaggcggatcgtatggctattccgactggcgaatacctc
agcgtagacggtaccccgcttgacttccgcaagggacgagtactgaaggatggcataaga
gaccccgctctcgaccgcgacccgtgcggctacgaccaccccctcgccatcgatggctgg
gaaaagggcaagttgatgctgcatgccgaggcgaagagcccgaccacaaacatctgcatg
aaggtgtactcgaccttcccatgcatgtgggtgtacacagccaacaacaagccactgccg
gcgagcggcggcccgggacagcggtacgcgcgttggactggtatgggactcgagccacag
tacttccctgacagcgcgaaccactaccccaagtacccgtcgtgcattgtgcgtcgtggc
gagaaccgcttcaccgaggtcatactcaacgagttcactgtcagtggcagctccaaggtg
tga

DBGET integrated database retrieval system