KEGG   Leishmania braziliensis: LBRM_34_1400Help
Entry
LBRM_34_1400      CDS       T01113                                 

Definition
(RefSeq) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
lbz  Leishmania braziliensis
Pathway
lbz00220  Arginine biosynthesis
lbz00330  Arginine and proline metabolism
lbz01100  Metabolic pathways
lbz01110  Biosynthesis of secondary metabolites
lbz01130  Biosynthesis of antibiotics
lbz01230  Biosynthesis of amino acids
Module
lbz_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:lbz00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    LBRM_34_1400
   00330 Arginine and proline metabolism
    LBRM_34_1400
Enzymes [BR:lbz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     LBRM_34_1400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 5419200
NCBI-ProteinID: XP_001568250
UniProt: A4HMH0
Position
35:complement(557090..558082)
Genome map
AA seq 330 aa AA seqDB search
MEHHLQKYKFYKEKNMSIVLAPFSGGQPLSGVELGPDYLLKQGLQQDMEKLGWNTTLERV
FDGKIVEARKANEKNDLIGHIKRPKLTSECTEKIYNSVRKVAEQGRFPLTVGGDHSIAVG
TVAGVLSVYPDTGVIWVDAHADINTMSGTVSGNLHGCPLSILLGLDRENIPECFSWVPQL
LKPHKIAYIGLRDVEEAEKKILHDLNIAAFSMHHVDRYGIDKVVRMAIDAVSPKGTEPVM
VSYDVDTIDPLYVPATGTPVRGGLSLREGLFLCERIAECGRLVALDVVECNPLLAATEAH
VKDTISFGCAIARCMMGETLLYTPRKKAKL
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggagcaccacctgcagaagtacaagttctacaaagagaagaacatgagcatcgttctt
gcccccttctctggtggtcagccgctcagtggggtagagctcggtcctgactaccttctc
aagcagggactgcagcaagatatggagaagcttgggtggaatacgactcttgagcgggtg
ttcgacggcaagatcgtcgaggcccgcaaggcgaacgagaagaacgacttaatcggtcat
atcaagcgcccgaagctgacgtcggagtgcacagagaagatctacaactctgtgcgcaag
gtggccgagcagggccgcttccctctcaccgtcggtggcgatcactccatcgccgtcggc
acggttgctggcgtgttgtccgtgtacccggacaccggcgtaatttgggtggacgcccac
gcggacatcaacactatgtccggcacggtctctggcaacctgcatggctgccccttgtca
atcctgctgggactcgatcgcgagaatatccccgagtgcttctcgtgggtaccgcagctg
ctgaagccgcacaagattgcctacattggtctgcgtgatgtagaggaggcggaaaagaag
atcctgcacgacctgaacatcgccgccttcagcatgcaccatgtggaccgctacggtata
gacaaggtggtgcgcatggcgatcgatgctgtctcaccgaagggcacagaaccagtgatg
gtgtcctacgacgtcgacacgattgaccccctctatgtgccggcgacgggcacccccgtg
cgcggcggcctctctttacgcgaggggttgttcctgtgcgagcgtatcgccgagtgcggt
cgtcttgtcgctctggacgtggtcgagtgcaacccgctcctcgccgctacagaggcgcac
gtgaaagacaccatctcctttggctgcgctattgcacgctgcatgatgggagagacactt
ctttacaccccgcgtaagaaggccaagctgtag

DBGET integrated database retrieval system