KEGG   Leishmania braziliensis: LBRM_34_1640Help
Entry
LBRM_34_1640      CDS       T01113                                 

Definition
putative ubiquitin hydrolase
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
lbz  Leishmania braziliensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
35:complement(637921..641415)
Genome map
AA seq 1164 aa AA seqDB search
MLAVLDVAKHVFWNDTAFNRKLLPSEAELEKCSYTITDLATMTGKERISVFKQCGIDPSL
FPLFLRSLQHITALHGAGKIDGSYMIHRHLSAHQWSPFSANTPLLGYANVNSSSYREQCS
SVAKETNKDDVGDLERGLGCYSRYNGLLNQGATCYLNSLLQALFHITAFRAIIYHMPTKD
EAEQHASVESTVPKSIPYALQRLFCHLQMSSRAVGTHELTESFGWGAADSFIQHDVHELT
RVLLDNLEEKLTAQQTETGNSTPKENAIHRLFTGSLESYVKVEEVNYYGSREEPFYDLQL
VVKNKMNIYSSFDAFFQVEVLDGKNKYCLECNGKKSYHRAEKGVRLKKIPPILLLHLARF
DYDIHQGETKVLTRWDYYNTLDLSCYMPESPATDTHYTLCSVLVHSGSNTGFGHYFCFLL
CSGAWYKFNDEVVTPAKLKEVFGDNFGGFKLNYWGSEIPNTANAYMLVYIRTSQLSSILC
PIGSDDVPQHVVQQLERERVAQERRVKEQAEDYLYGRVHFILPSDIVDQEEYLMSRRPVT
QRLPSHKTLRILLDDEALPAFQNFVTQQFGVNAEQQLLWFASSRTGGSEIRLSRQVRANM
KVRQLLQSAKECCVLVTTPTTAPVIELDQGCTYREYEVFHHKLYDPLQLKVFFLGCTVLH
RDPSGNIKQACESMELHVRALIADLPNLTKQLHGHHLKKPPEAKQTLPSKPWSAGSLETY
RSHQDLVSREEAEAVVVRRGMPQEALGAVRETETHEFLPCNELYSGDILIWKLDTPNEDP
ANVFYPNIQSFQHFLQHRIPVELKLNRNPDYPLLIATELAEDMTYEQLQRYTARLIGDIE
NYDRIRFTRHNPETELPYFMKGKKHDRATLARLLMPASSRVPALSKYLYYEYCKYTVTEI
ENAHSLQFKLYGDNVKVVSAHWILLPHDLPITAELLFPACVREIQKDYAIGACPAVAALL
NEDPERAANNSTIAFVKRLMQMDCKSAHEWLRLVDVWRGRVYNILDKNHVLLFEHNTFEE
SAEYRIEHLPAPIPGIRPSDQAVFQVHHFTMVRQRRDAIETHSEPFSMYVNFNETSNQLL
RRIAVKLEMIYAAVQDWKVCLVKESRVKVIAPDALMGTHITNFCPLECYQPNQIEPSKAA
FIGLEHAPLSKRTGKREDKVLILN
NT seq 3495 nt NT seq  +upstreamnt  +downstreamnt
atgcttgctgttttagatgtggcaaagcacgtattttggaatgacactgcgtttaataga
aaactgcttccctcggaagctgagctggagaaatgcagctacacgattactgacctggcg
accatgaccgggaaggagcggatttctgtcttcaaacagtgcgggattgacccttctctc
tttcctctttttctgaggtcacttcagcacatcactgctcttcatggagcgggtaaaatt
gacggcagttacatgattcatcggcatctgagtgcacaccagtggagtcccttctccgct
aacactccccttctaggctacgcgaacgtgaatagctcatcgtaccgcgagcagtgctca
tctgtagcaaaggagacaaataaggatgatgtaggtgacttggaaagaggcctaggctgt
tattcccgttacaatggtctgctcaatcagggcgcaacctgctacctcaactcgcttctc
caggctctctttcatataacagcgtttcgggctattatctatcacatgccgactaaagat
gaagcggagcaacacgccagcgtggaatcgacagtgcccaaaagcattccatatgccctg
caacgacttttttgccacttgcagatgtcgtcgcgcgctgtcggcacacacgaactaact
gagtcatttgggtggggagcagccgatagctttattcaacatgacgtgcatgaactaacg
cgcgttcttctcgataatttggaggagaagctgactgctcaacaaactgaaaccggaaat
tcgacgccaaaggaaaatgcgattcatcgcctcttcacaggctccttggaaagctacgtc
aaagtcgaagaggtgaactactacggatcccgtgaagagccgttttatgatctccagctt
gttgtgaagaacaagatgaacatatactcgagcttcgacgcttttttccaggtcgaggtg
ctggatggaaaaaacaagtactgcctagaatgtaatgggaaaaagtcgtatcatcgtgca
gaaaagggcgtccggctcaagaagatccctcccattctccttctgcacctggcacgcttt
gactatgacattcaccagggtgagaccaaggtgctgacgcgctgggactactacaacact
ctggatctgtcgtgttacatgccggagtcgccggcgacggatacgcactacaccttgtgc
agcgtactggtgcactccgggtcaaacactggttttggccactatttttgcttccttcta
tgctctggtgcttggtacaagttcaacgatgaggtagtcaccccagcaaaactgaaggag
gtgtttggtgacaactttggtggcttcaagctcaactactggggttctgagatcccaaac
accgccaacgcgtacatgctcgtgtacatccgcacaagccaactcagctccattttatgc
ccgattggcagcgatgacgtcccacaacatgtggtacagcagctggaaagagagcgtgtt
gcgcaagagcgtcgcgtcaaagagcaagctgaagactacctctacgggcgagtgcatttc
atactgccgagcgatatcgtcgaccaggaagagtaccttatgtcgcgtcgaccagtgacg
cagaggctcccctctcacaaaactctgcgcattttgctcgacgacgaagcgttgcctgct
tttcagaactttgtgactcagcagtttggtgtcaacgccgagcagcagttgctgtggttt
gcctcatcgcgtacaggtgggtcagaaattcggctttctaggcaagtcagggcaaacatg
aaggtgcgacagctcttgcaaagtgcaaaggagtgctgcgtgctcgtcacaactccaaca
actgccccagtaatcgagctcgatcagggctgcacgtaccgcgagtacgaggtgtttcac
cacaagctgtacgacccgctgcaactcaaagtgttttttctagggtgcaccgtgctgcac
cgcgatccgagcgggaacataaagcaggcctgcgaaagcatggagttacatgtgcgcgcc
cttattgctgacctgccaaacctgacaaagcaactgcacggccatcatctgaagaagccg
ccggaggcaaagcagacactaccgtcgaagccatggagtgccggctcgctcgagacctac
aggtcacaccaggatctagtctcgagggaggaggcggaggcggtcgttgtgaggcgtggt
atgccgcaggaagcgttgggggcagtgcgggaaaccgaaacgcacgaatttttgccgtgc
aacgagctttactcgggtgacattctgatctggaaactcgacacacctaacgaggatcca
gcgaacgttttctaccccaacatccagagctttcagcacttcctccagcaccgaatcccg
gtggagctgaagctcaaccgcaacccagattaccctctactaattgcaaccgagcttgca
gaggacatgacgtacgagcagctccagcggtacactgcacggctcatcggcgacattgag
aactacgaccgcattcgctttactcgccacaacccggaaacggagctgccgtacttcatg
aagggtaagaaacacgatcgtgcaactttggcgagactgttgatgcctgctagttcgcgg
gttcccgccctgtccaagtacctctactacgagtactgcaagtacaccgtcaccgaaatt
gagaatgcacactcgctgcaattcaagctgtacggcgacaacgtcaaagtagtgtcggcg
cactggattctgctgccgcatgatcttcccatcacggcggaactgctctttcccgcctgt
gtgcgcgagattcaaaaagactacgcaatcggtgcctgcccggcggtggcagcgctgctc
aacgaggatccagaacgcgcagccaacaactccacgatcgcctttgtgaagcggctcatg
cagatggactgcaagagcgcacacgagtggctgcgtctggtcgacgtgtggcgcggtcga
gtgtacaacatactggacaaaaaccacgtgcttctctttgaacacaatacctttgaagaa
agtgcggagtatcgtattgagcatcttcccgcacccattccaggtattcgcccctcagac
caggcggtgtttcaggtgcatcacttcaccatggtgcgccagcgccgcgacgctattgag
acacatagtgaacctttcagtatgtatgtcaacttcaacgaaacgtcgaatcagctgcta
cgccgtatcgccgtgaagctggagatgatctacgccgcggtgcaggattggaaggtgtgt
ctagtgaaggagagccgggtgaaagtgattgcaccggatgctctgatggggacccacatt
accaacttctgtcccctagagtgctaccaaccgaaccaaatcgagccgtcgaaggcagct
ttcattgggctggagcacgctccgctctcaaagcgaacaggcaaacgcgaagacaaggtg
ctgatcctcaactga

DBGET integrated database retrieval system