KEGG   Leishmania braziliensis: LBRM_34_2990Help
Entry
LBRM_34_2990      CDS       T01113                                 

Definition
putative glycerol kinase, glycosomal
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lbz  Leishmania braziliensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbz00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    LBRM_34_2990
Enzymes [BR:lbz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     LBRM_34_2990
Exosome [BR:lbz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LBRM_34_2990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
35:complement(1170531..1172069)
Genome map
AA seq 512 aa AA seqDB search
MPYVASIDQGTTSSRCIIFDEKFSILSEHQLAHEQITPQPGWLEHDPEEIYRNCCLCLAE
AVKKLRAKDPKFDKVSAIGITNQRETGVAWDRQTGKPLCNAIVWSDARTYEVSNRIAKDF
GGGDHNFAAHITGLPVSTYFTAFKFRWMLENVPAVAAARKSNMLLLGTIESWLLWKLSEG
KVFVTDVSNASRTFLMNLSTQQWCDELCEKLDIPRTALPAIRSNSERYCDVTANDYGIRD
ALGVPTPVAGCIGDQQSALFGHMGLHKGDAKNTYGTGCFMLMNVGTEPQFSKNGLLGTIA
YKLGTESAKFALEGSIAGAGATMEWMRSNLNFYSHPREIDNIARQVSGTDGVVFVPAFGG
LLAPYWDPTARGTLLGMTYKTNKSHIIRAALEAISMQVNAVLLAMKEDSGVEIKCLRVDG
GLTRSRLLMEMQADILGVDLYVPRLTETTALGAALCAGLAVGVWKSVKEIQKTAKEQLSG
ETVSPTMTDKQVRKARLEAWNAAVKRSKWAKL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgccatacgttgcttctattgaccagggcaccacctccagccggtgcatcatcttcgat
gaaaagttttccattctctcggaacaccagcttgcccacgagcagatcacaccacagcct
gggtggctggagcacgacccggaggaaatctacaggaactgctgcctctgcctcgcagag
gcggtgaagaagctgcgcgcaaaggaccccaagtttgacaaggtgtcagccatagggatc
acaaaccagcgtgagacgggtgtcgcctgggaccgccagactgggaagccgctctgcaac
gccatcgtgtggagtgacgcgcgtacctatgaggtgagcaaccgcattgcgaaggatttt
ggtggcggcgaccacaacttcgccgcccatatcactggtctgccggtcagcacctacttc
actgccttcaagttccgctggatgctggaaaatgtgccggccgtagccgccgcgcgcaag
agcaacatgctcctccttggcaccatcgagtcatggcttctgtggaagctgagtgagggc
aaggtgtttgtgacggatgtgtcgaatgccagccgcaccttcctcatgaatctgagcaca
cagcagtggtgcgacgagctctgcgagaagcttgacattccgcgcacggcactgccggcg
attcgcagcaacagcgagcgatactgcgatgtcacggccaacgactacggcatccgtgac
gcgctcggcgtgccgacgcccgtggcgggctgcattggtgatcagcagagcgccttattt
ggccacatgggtttgcacaagggtgatgccaagaacacgtatggaacgggctgcttcatg
ctcatgaacgtgggaacagagccgcagttctcgaagaatggtctgctcggcactatcgcc
tacaaactgggcacggagtcggccaaatttgccctggagggctccattgccggcgccggt
gccacgatggagtggatgcggtcaaacctcaacttctacagtcacccgagggagatcgat
aacatcgcccgccaagtaagcggcaccgacggagtcgtgtttgtgccggcctttggcggg
cttctcgccccttactgggacccgacagctcgtggcacccttttgggcatgacatacaaa
acaaacaagtctcacatcatccgcgccgccctcgaggccatctcgatgcaggtaaacgca
gtgctgctcgctatgaaagaggacagcggcgttgagatcaagtgcctgcgcgttgacggg
ggcctcacgcgtagccgcttgctcatggagatgcaggccgatatactgggtgtggatctt
tacgtgccgcgtctcaccgagaccaccgcccttggcgccgccctttgcgctggtctggcc
gtcggcgtgtggaagtctgtcaaggagatccagaagacggccaaggagcagctgagtggt
gaaacggtgagtccgaccatgaccgataagcaggtgcgcaaggcacgcctggaggcctgg
aacgctgccgtgaagcggtcgaagtgggcgaagttataa

DBGET integrated database retrieval system