KEGG   Leishmania braziliensis: LBRM_34_3990Help
Entry
LBRM_34_3990      CDS       T01113                                 

Definition
(RefSeq) protein kinase A catalytic subunit isoform 1
  KO
K04345  
protein kinase A [EC:2.7.11.11]
Organism
lbz  Leishmania braziliensis
Brite
Enzymes [BR:lbz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     LBRM_34_3990
Protein kinases [BR:lbz01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   LBRM_34_3990
Messenger RNA biogenesis [BR:lbz03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     LBRM_34_3990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
35:1517070..1518188
Genome map
AA seq 372 aa AA seqDB search
MSSAAMDKGAAPALILPKREEKSKSPTNVSNPLDPSKPAIATNAKSAYLFEKPDTSHWAL
SDFEMKNTLGTGSFGRVRIAHRKGTDEYYAIKCLKKREVIKMKQQQHLAQEKGILMEVSH
PFIVNMMCSFQDEKKVYFVLEFVMGGEMFTHLRTAGRFPNDVAKFYHAELVLAFEYLHSL
DVIYRDLKPENLLLDNKGHVKVTDFGFAKKVPDRTFTLCGTPEYLAPEVIQSKGHGKAVD
WWTMGVLLYEFIAGYPPFYDDTPFRIYEKILAGRLKFPNWFDGRARDLVKGLLQTDHTKR
LGTLKGGPADVKNHPYFHGANWDKLYARYYPAPIPVRVKSPGDTSNFEKYPDSPVDRTPA
LTSAQQAEFKGF
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctgctgccatggacaaaggtgcagcgccggcgttaatcctcccgaagagagag
gaaaagtcgaagtcaccaacgaatgtctcgaatccgctcgacccgtcgaagccggccatc
gcgacaaacgccaagtcagcctatttatttgagaagcccgacacctctcactgggcactc
tcagactttgagatgaagaacacgctcggcaccgggtccttcggtcgtgtacgcatagcc
caccgcaaaggcacggacgagtactacgcgatcaaatgcctgaagaagcgggaggtcatc
aagatgaagcagcagcagcaccttgcacaggagaaggggatcttgatggaggtgtcgcac
ccgttcatcgtgaacatgatgtgctctttccaagacgagaagaaggtgtactttgtgttg
gagttcgtgatgggcggcgagatgttcacgcacctgcgcactgcagggcggtttcctaac
gatgtggcgaagttctaccatgcggagctggtgcttgcgttcgagtacctgcactcgcta
gacgtgatctatcgcgatctgaagccggagaacctgctgctggacaacaaggggcacgtt
aaagtgacggactttgggtttgcgaagaaggtgcccgaccggaccttcacgctgtgcggg
acgccagagtaccttgcaccggaggtgatccagagcaagggccatgggaaggcggtggac
tggtggacgatgggcgtgctgctgtacgaattcattgcaggatacccgccgttctacgac
gacaccccgttccggatctacgagaagattcttgctgggcggctgaagttccccaactgg
ttcgatggccgcgcgcgcgaccttgtgaaggggcttctgcagacggatcacacaaagcgt
ctggggacgctgaagggcgggcccgcggacgtgaagaaccacccgtatttccatggcgcg
aactgggacaagttgtatgcacgctactaccccgcaccgatcccggtgagggtgaagagc
cctggcgacacgagcaacttcgagaagtacccggatagcccggtcgaccgcacgcctgca
ttgacgtcggcgcagcaggctgagttcaaaggcttttag

DBGET integrated database retrieval system