KEGG   Leishmania braziliensis: LBRM_34_3990Help
Entry
LBRM_34_3990      CDS       T01113                                 

Definition
(RefSeq) protein kinase A catalytic subunit isoform 1
Organism
lbz  Leishmania braziliensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
35:1517070..1518188
Genome map
AA seq 372 aa AA seqDB search
MSSAAMDKGAAPALILPKREEKSKSPTNVSNPLDPSKPAIATNAKSAYLFEKPDTSHWAL
SDFEMKNTLGTGSFGRVRIAHRKGTDEYYAIKCLKKREVIKMKQQQHLAQEKGILMEVSH
PFIVNMMCSFQDEKKVYFVLEFVMGGEMFTHLRTAGRFPNDVAKFYHAELVLAFEYLHSL
DVIYRDLKPENLLLDNKGHVKVTDFGFAKKVPDRTFTLCGTPEYLAPEVIQSKGHGKAVD
WWTMGVLLYEFIAGYPPFYDDTPFRIYEKILAGRLKFPNWFDGRARDLVKGLLQTDHTKR
LGTLKGGPADVKNHPYFHGANWDKLYARYYPAPIPVRVKSPGDTSNFEKYPDSPVDRTPA
LTSAQQAEFKGF
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctgctgccatggacaaaggtgcagcgccggcgttaatcctcccgaagagagag
gaaaagtcgaagtcaccaacgaatgtctcgaatccgctcgacccgtcgaagccggccatc
gcgacaaacgccaagtcagcctatttatttgagaagcccgacacctctcactgggcactc
tcagactttgagatgaagaacacgctcggcaccgggtccttcggtcgtgtacgcatagcc
caccgcaaaggcacggacgagtactacgcgatcaaatgcctgaagaagcgggaggtcatc
aagatgaagcagcagcagcaccttgcacaggagaaggggatcttgatggaggtgtcgcac
ccgttcatcgtgaacatgatgtgctctttccaagacgagaagaaggtgtactttgtgttg
gagttcgtgatgggcggcgagatgttcacgcacctgcgcactgcagggcggtttcctaac
gatgtggcgaagttctaccatgcggagctggtgcttgcgttcgagtacctgcactcgcta
gacgtgatctatcgcgatctgaagccggagaacctgctgctggacaacaaggggcacgtt
aaagtgacggactttgggtttgcgaagaaggtgcccgaccggaccttcacgctgtgcggg
acgccagagtaccttgcaccggaggtgatccagagcaagggccatgggaaggcggtggac
tggtggacgatgggcgtgctgctgtacgaattcattgcaggatacccgccgttctacgac
gacaccccgttccggatctacgagaagattcttgctgggcggctgaagttccccaactgg
ttcgatggccgcgcgcgcgaccttgtgaaggggcttctgcagacggatcacacaaagcgt
ctggggacgctgaagggcgggcccgcggacgtgaagaaccacccgtatttccatggcgcg
aactgggacaagttgtatgcacgctactaccccgcaccgatcccggtgagggtgaagagc
cctggcgacacgagcaacttcgagaagtacccggatagcccggtcgaccgcacgcctgca
ttgacgtcggcgcagcaggctgagttcaaaggcttttag

DBGET integrated database retrieval system