KEGG   Leishmania braziliensis: LBRM_35_0840Help
Entry
LBRM_35_0840      CDS       T01113                                 

Definition
putative mitogen-activated protein kinase
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
lbz  Leishmania braziliensis
Brite
Enzymes [BR:lbz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     LBRM_35_0840
Protein kinases [BR:lbz01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   LBRM_35_0840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
36:238139..239521
Genome map
AA seq 460 aa AA seqDB search
MSNEIESHILKKYEIQTQLGQGAYGIVWRAVERKYNRIVALKKIYDAFQNSTDAQRTFRE
IMFLHRLHHPNIIKLLHVHRAYNDRDIYLVFEYMETDLHVVIRANILEEIHKQFIMYQLL
KTMKYLHSAEILHRDMKPSNLLINSDCTMKVADFGLARSILSLESEQASRPVLTDYIATR
WYRPPEILLGSTRYTKGVDMWSVGCILGELMLGKPIFPGRSTTNQLELICSVTGMPSSAD
VAATNSQFAHAMLRDIHLSHRRTFAELLPNASADALDLIQRLMCFNPNRRISAKEALGHP
YVAAFHRPDEEPVAPDPITISLPDNERLPLDKYRDAIYEQIAALRRCSASGEQRQRMERQ
ASSGTPSRKTSTSSGAAAAAAATSGSRAGTSSSTITRSNASSSAAVRVVPQRSTVKSTST
SGVNDSVPSKTYARPAFRQAAPSTTAIESRPVARETVVRK
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacgagattgagtcgcatattctaaagaaatatgagattcaaacgcagctagga
cagggtgcatacggcatcgtttggcgcgccgtggagcgcaaatacaaccgcatcgttgcg
ctcaagaagatctacgacgcttttcaaaactcgacagatgcgcagcgcaccttccgtgag
attatgttcttgcaccggctgcaccaccccaacatcatcaagcttctgcacgtccatcgc
gcctacaatgatcgcgatatctaccttgtcttcgaatacatggagacggacctgcacgtg
gtgattcgggcaaacatcttggaagaaattcacaagcagttcatcatgtaccagctgctc
aagacgatgaagtacctgcactctgccgagattcttcaccgtgacatgaagccaagcaac
ctgcttatcaacagcgactgcacgatgaaggtggctgacttcggtctcgcgcgctccatc
ctttcacttgagagtgagcaggcgtcgcgtccggtgctaacagactacattgcgacgcgg
tggtaccgtccgccggagattctgcttggatcgacacgatacactaagggcgtagatatg
tggtcggtgggctgcattcttggagagctgatgcttggcaagcccatctttcccggccgc
tccaccacaaaccagttagagcttatctgcagcgtgacaggcatgccttcctcggcggat
gtggcggcgaccaactcgcagtttgcccacgccatgcttcgcgacatccacctctcgcac
cgacgcacattcgccgaacttctgccaaacgcttctgcggatgcgttggaccttatccag
cgcctgatgtgcttcaacccaaaccggcgcatcagtgcgaaagaggctctgggacacccg
tacgtggctgcctttcaccgtcctgacgaggagccggtggcgcccgatcccatcaccatc
tctctccctgacaacgagcgcctgccattggacaagtatagagacgccatctacgagcaa
attgccgcgctgcgccgttgctccgcgtctggcgagcaacggcagcgcatggagcgacaa
gcttccagcggtacccctagtcgcaagacgtccaccagcagcggcgccgccgccgctgct
gctgctaccagtggctctcgagcaggcaccagctcctctacaatcacgcgatccaacgcg
agcagcagcgctgccgtacgagttgtaccgcagcgcagcactgtaaagtctacttcgacc
agtggcgtcaacgattctgtaccttcgaagacgtatgcccgtcccgccttccgccaggca
gcgccttccaccactgctatagaaagtagacccgtcgcgcgcgagacagtggtacgcaag
tga

DBGET integrated database retrieval system