KEGG   Leishmania braziliensis: LBRM_35_0900Help
Entry
LBRM_35_0900      CDS       T01113                                 

Definition
hypothetical protein, unknown function
Organism
lbz  Leishmania braziliensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
36:291986..295381
Genome map
AA seq 1131 aa AA seqDB search
MMRRPGVEYCTATSSIHGTLGTPSSSSLLPVSRTSAADNYSSCKSGIPPLTGTLSPAPLQ
TPPPPSSSLFTSGFYDAGGRDVRETKHNTQRQQKVLQQEEEVARLEATLARERVESADSL
NVVRASLQRERLRSTMAEQGQQAAQAEAKQLRIALRALLAQPPDSSNIVSSSLMVPVSLY
EEARRLLLRCKRAFAELKALQLRATDSAGFQLFHQYDIPALDEIPPAWPPETPQRCGKEE
EEPALDVARGDCSAPSTSASREKVATGTVSLPMEETPIGPEVSVLTTVSPDTPHSTSTET
QQLSAVTTASDTAEKWQERVNVLPAHNPSNVVGKPDIGGETVSAYCGRRPRPVLLSPPLP
SPEPSILNTLTPWTGPMHEFAESTTVLSSAASQQLDAMHPPQLREGEEERAIRDADRLLR
QWAEKVETLATRQGLRAASEVAALCRRHGLHYIDAAFLPVSETLGLDSGRGCRGYGPGCG
TSFVVQWCHRDTVVPHDRKAELLTSAGINPSSLRCGRLGDVGVVAALAALAEATGAVTSV
LASTTSEDEDNGLYVVWLCMHGWWTRVSVDAYLPCVIEQNRFVALYGCSSATTPYDLWAP
VCEKALAKVLGGYHSLSSLTAEAAIGSFTGGPVECWDWWHSRSDTALEEMEAVLNTNARG
AGVVLLSTFSTAVLRDTPARPVAVAGAQAAYQRLGLQPGTSYRVLAVADNAEGDPMVLLR
KWTRQCEQQEESQVDRLFDRHAEDSGGGGRCVISPPRDSDDGIAAAERWLAKLPPPSGVA
PSHGDSCVWLSYAKEVLPYFDGCHVCFDCRRYHDLRIPIKFSGSRLAIPAQIVRVRVREG
PVRPTHGLTRCPTRLWIGLHQPCTSAAHNVAVPGAFLWGLKMTLVGQEEALAPFGGDGDR
VRPARRSYVLSESFLGEPKELPAVWMYLELESATDAPPDSATILREEDTDAPSVTTEFFV
VPQMEWIVRKDRAHASQDDNGLGSLGVGAPCAQSRRSVEQDSQLHHISKCAAPCGDGGKY
ADAVARALRHDCSERHLPSLAEHSFGETTTAIVAVLAEHRESLLVDVVDAPAELRAAVYH
DVLDRIDFSDCTLAGGSGRRHISHLSLPGAATEQGEVCCQLNGRCMPTFSW
NT seq 3396 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgtcgcccaggtgtggagtactgtacagccacgagctctatacacggaaccttg
ggcacgccttcctcgtcaagcctgctgccggtgtcgcgcacctccgcagcggacaactat
agctcatgcaaaagtggaattcctccactgacggggacgctgtcaccagcgccgctgcag
acgccgccgccaccgtcgtcatcgttgttcacctccgggttctacgacgctggaggcaga
gacgtgagagagaccaagcacaacacgcagcggcaacaaaaggtgctgcaacaggaagag
gaagtggcgcgtctcgaagctaccttggcacgagaacgcgtcgagagcgccgactcactg
aacgtcgttcgagcgtccctgcagcgcgagcgcttgcggtccaccatggcggaacaaggg
caacaggctgctcaggcagaggccaagcagctgcgcattgcgctccgggctctcctagct
cagccccccgacagtagcaatattgtatcatcatcactgatggtgcctgtttccctttac
gaagaggcgcgccgcctcctcctgcggtgtaaaagggcgtttgcggagctgaaggcgctc
cagctgcgcgccactgactccgctggttttcagctattccaccaatacgacattccggca
ctcgacgagattccgcctgcgtggccgcctgagacaccacagcgctgcggcaaagaggag
gaggagcccgcgctcgacgtcgcgcgtggtgactgtagcgctccttctacctctgcctcc
cgcgagaaggtggccactggcactgtctcgctcccgatggaggagacgccaattggacct
gaggtatccgtgctgaccactgtctcccccgacacaccgcacagcacgagtactgaaacg
cagcagctcagtgcggtcacaactgccagtgatactgcagaaaagtggcaggagagggtc
aacgtactccctgcccacaacccttcaaacgtagtaggcaagcccgacatcggaggcgaa
accgtcagcgcctactgcggtcgtaggccacggcctgtcctcctcagtcccccgctccca
tcgccggaacccagcatcctcaacaccttgacgccctggacaggacctatgcacgagttt
gccgagtcgacgaccgttctttcttccgcagcgtcgcagcaactcgacgcgatgcacccc
ccgcagctccgtgagggggaggaagagagggcgatccgtgacgcagatcgccttctccga
cagtgggcagaaaaggtagaaacactggcaacgaggcagggactccgtgcagcgtctgag
gtagccgcgctgtgccgccgccacgggctgcactacatcgacgctgcgtttcttcccgtg
tcggagacgcttggccttgacagcggtcgcggttgccgcggctacggtccaggctgcggc
acttcgtttgtggtgcagtggtgccaccgcgacaccgtcgtgccgcatgataggaaagct
gagctgctgacaagcgccggtattaacccgagctcgctgcgctgcggccgactgggcgac
gttggtgtagttgccgccttggctgcactcgccgaggccactggtgcggtgacgagcgtg
ctcgccagcacgacgagtgaggacgaggacaatggcctctatgtggtctggctctgcatg
catggctggtggacacgcgtctcagtcgacgcgtatctgccgtgtgtcatcgaacaaaac
aggtttgtcgccctgtacggttgcagcagcgccaccaccccctacgacctctgggcaccg
gtgtgtgagaaagcgctagccaaagtattgggtggctaccactcgctcagcagcctcacg
gcggaggcggcgataggcagctttacgggaggaccagtcgagtgctgggattggtggcac
agtcgtagcgatacggcgctggaggagatggaggcggtgcttaatacaaacgcgcgcggc
gcaggtgtagtgttgctctccactttttcaacggcagtcctgcgcgacacgcccgcaagg
ccggtggctgtggctggggcgcaagcggcctaccagcggctcgggcttcaacctggcacg
tcgtaccgggtgctggccgtggctgacaatgcggagggtgatccaatggtcctcctgcgc
aaatggacacgacagtgtgagcaacaggaggagagtcaagtggaccgtctctttgatcgc
catgccgaggatagcggcggcggtggccgttgcgttatctcgccgccgcgggacagcgac
gatgggattgctgccgctgagagatggttggcaaagctgccgccaccgtcgggtgtggct
ccgagtcacggcgactcgtgtgtttggctgagctatgccaaagaggtgctgccctacttt
gatggctgccacgtgtgttttgactgccgccggtaccacgaccttcgcattccaattaaa
ttctctggctctaggctggccattccagcgcagatcgttcgtgttcgtgtgcgagaaggc
cctgtgaggcctacgcacgggttgacgcgctgtcctacacgactgtggattgggttacac
cagccatgcacctccgccgctcacaatgtagctgttcctggtgcctttctgtggggactg
aagatgactctggtgggtcaagaggaggctctggcaccctttggaggagacggcgaccgt
gtgcgtccggcgcgccggtcatacgttttgtccgagtccttcttgggcgaaccaaaggag
ctgccagcggtttggatgtacttggaactggagtcagccaccgacgctccgcctgattct
gccaccattctcagagaggaggacaccgatgcgccgagcgtgacgaccgagttctttgtt
gtaccgcaaatggaatggatcgtgcggaaggacagggcacacgccagccaagatgataat
ggacttggctctctgggggttggcgcaccctgtgctcagtctcggcgcagtgtggaacaa
gacagtcaactccaccacatcagcaagtgtgctgcaccgtgtggcgacggaggcaagtac
gcagatgctgtggcgcgtgcgctacgtcacgactgcagtgagcgccatctccccagccta
gctgaacactcatttggcgaaaccacgacggctatcgtggcagtcttggcagagcacagg
gagtcgttgctggtagacgtcgtcgacgcaccggcggagctgcgcgcagccgtttatcac
gacgtgctggatcgtatcgacttctctgattgtacacttgcagggggcagtggccgtcgc
catatatcccacctgtcgctgccaggtgccgctacagagcagggtgaggtgtgctgccag
ctgaatggccgctgcatgccaacgttttcatggtga

DBGET integrated database retrieval system