KEGG   Leishmania braziliensis: LBRM_35_0920Help
Entry
LBRM_35_0920      CDS       T01113                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
lbz  Leishmania braziliensis
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:lbz00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    LBRM_35_0920
  Replication and repair
   03420 Nucleotide excision repair
    LBRM_35_0920
Transcription machinery [BR:lbz03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     LBRM_35_0920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
36:301525..303210
Genome map
AA seq 561 aa AA seqDB search
MSSSSSVLDVPFIEVICSHPAREVLCAECPALLLLIYEHVVAELQAGRRAVDVFRGTSRQ
DHLSELLAMSSFSELFQRLYPPSQSCGADDGAASTYFWRQVRVTLEAAWSQPCDAKARAL
LTQVHGQPRFHFCGPRDAVVPGEGYPLHPVSLERALATSKRFLRTATTCALDGSADALGG
RQPELCAVLQLARLVPHVPLTGVAPKKEVTPEGISFCMVSLQQRWWVLVNAALERVLLLT
RASVNSSSNTSGSSRVTKPLLWQLLAVLSVLDTAHYIFAFPERQQDFAAHLLLARLAEVG
LVYPVLRDDRRCFVVSPDFLHAIHWHANAPLSFTFNHYLVRSGSGFNDSRVSAIRREDTD
TIITETNFRLYAYTEDSDLLNILHQFAELEEVVNGNLHCYRVTRDSFAAAMRKGITATQV
LRFLSLRAHPSMLRRYGEKEENGDTKSPSPAGGAPSSTFSAPPRRAAVAGTRGSTTFIDA
VTTLVVPHSFCDQLRMWERECRRVVFEHHVVLLRNVSTEQQKAVTAYLADAGEVDAVVHT
ERGYMVIREEVFDRLIAPLLE
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcgagctcgtcggtactagatgtgccgtttatagaagtcatttgcagccatccc
gcccgcgaggtgctgtgcgccgagtgccctgcactgctgctgctcatctacgagcatgtc
gtagcagagctgcaggcagggcgacgcgccgtggacgtgttccgtggcacctctcgacag
gaccacttgagtgagttgctggcgatgtcctccttctcggagctgtttcaacgcctttat
ccgccgtctcagtcttgcggcgccgatgacggtgctgcgagcacgtatttctggaggcag
gtgcgagtgaccttggaggccgcgtggtcgcagccgtgcgacgcaaaggcgcgtgctctt
ctcacccaggtgcacggtcagccgcggttccacttttgcgggccgcgcgacgccgtagtg
cccggggagggttatccactgcatcccgtctcgctggagcgggccttggcaacgagcaag
cgcttcctccgcacggccacaacctgtgcgctggacgggtcagcggatgccctgggcggg
cggcaaccggagctgtgcgcggtgctgcagttagcccggctggtgccgcacgttccgctg
acgggagtagccccgaagaaagaggttaccccggaggggataagcttctgtatggtgtcg
ttgcagcagcggtggtgggtgctggtgaacgcggcgctggagcgcgttctgctgcttacg
cgcgcttccgtgaatagtagcagtaacactagcggaagcagcagggtcacaaagccgcta
ctgtggcagctgctggcggtgctgtctgtgctagacacggcgcactacatcttcgccttc
ccagagaggcagcaggattttgcggctcatcttcttctcgcacgactagccgaggtcggg
ctagtgtaccccgtgctcagggacgaccgcaggtgctttgtcgtgagtcccgatttcctg
cacgctattcactggcacgcaaatgcgccgctttcctttacctttaatcactatcttgtg
cgcagcggcagcggctttaatgactcgagggtaagtgcaatacgtcgcgaggacaccgac
acaatcataaccgaaacgaacttccgcctgtatgcctacaccgaggactccgatctactt
aacattttgcaccagttcgctgagttggaggaggtggtaaacgggaatctccactgctac
cgcgtgacgcgggacagtttcgctgccgctatgcgcaagggcatcaccgccacacaagtg
ctacgctttctttcgctgcgagcacaccccagcatgttgcgccggtacggagagaaggag
gagaacggcgatacaaagtcgccgtcgcccgctggcggtgccccgtcttcgactttttca
gcgccgcctcgtcgcgcggccgtggcgggcacgcgcggaagcaccacgttcattgatgcg
gtgacgacgctggtcgttccgcactcgttctgtgaccaattgcgcatgtgggagcgtgag
tgtcgccgagtagtgtttgagcatcacgttgttctgttacgcaacgtgtcgactgagcag
cagaaggcggtgacagcgtatttggcggatgcgggagaggtcgatgccgttgtccacacg
gagcgcggctacatggtgattcgggaggaagtcttcgatcgtcttatcgcaccacttttg
gagtga

DBGET integrated database retrieval system