KEGG   Leishmania braziliensis: LBRM_35_1780Help
Entry
LBRM_35_1780      CDS       T01113                                 

Definition
putative clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
lbz  Leishmania braziliensis
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:lbz04144]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
36:complement(651780..656864)
Genome map
AA seq 1694 aa AA seqDB search
MNSPSLSLEVFQLNSVSGGLRPGSIAFKNVTVESEKYVCVRDVQEDGQTSLVIVDIEKRE
SIRNNVKDAESCIMNPRSKILALRSGRNLQVFDVEASRRLKATLFHDDVVHWGWIDDRTL
GIVTGKAVYHWSLDGAADDAPLHIFDRSADYDSSVQVLSYRSDEQKKWLLVTGVARDPSG
AMVGKALLYSVENRSSRVLDGHACCFISTPTPSESRKCNVMCLAWNSPQQGGQVMIMELP
TGSKTDLSLPRRIYNLRIQPGDFPVAMHVSDRHKLLTVVTSRGTFALMDIFTGVIVAEQQ
FTPAVVFRGAGDNKVGGVVCVNNQGSVMRIGPNDSGIINYIKNNMQNPELALRIASTANL
GGVDDLFKVQLDNYLRIGNIEEATRICLRAPGNMLRTREILMNFMQMPQQPGQPPAISTY
FKIVLAETSLNEYESVELARAVVPKGGIGYVKQQFDEGKLTASEELGDMVQQADPNMALK
IFHQGNVHAKVLNVLLQRNETQKAVEYCKRSNFSPDWRVIVNNFIRVAPQDAVNLCLMLY
REMGDKPVLSAEEMMDMFVSAQQIQQATEFLLEVLRDHNDESTMDLQTKLLEINLKYSHP
SVADKIFVRNICQYYDGMKLAPLCERVGLHQHAIECYMIAQKQDPNLNNLSSIRRCLKQL
QSFNPEWLVEFFGKLNKQESLKCLEDLCTNSRQSFKVLVQVATKYSDALGSTDLIGMFLE
HNLYDVLYYYLGAVVPYTRDAEVHFRYIEAAAEMGQMQELERMTRESPCYDAERTKNYLK
SKKLTDLWPFINVCDQHNMVNEMVHYLVETSNENYIEQYVTRRSPGKTPQVVQALIECNV
SEDFITNMLSVVGTMCPSEELVQCVEETGRLHLIKQWLEDRRSEKKTDKALYNALAKIYV
DIGQSPEQFLAENEYYDALVVGRYCETRDPNLAYIAYSHDHCSKELVDLCYRNGMYKQLA
RYLVKEQDLDLWTSVLAEDTAHRQQLVESVQQTALPESVVSEEVSTTVRAFMNANLTEEL
TALLSQIVVHGRFRKNRFLENLLIMSAVRSRKDKVMEYVTTLEDYDGADIAHLASGAGMH
EVAFVVYTRHNMQKEAIKVLLQDMNDVSRGRAFAQKTDTAAVWSVLGEYLVKQDEVHEGI
ECLIKAKNPDLVVEVTSAAERTNQYSDLIKYLSMARQYSRAKDSKIDTALVITYAKTGRL
GELEEFLKQAHNVKIGAIADKCFDEKLYESARVLYTVANNYARLASTEVMLSNLPNAVEA
AKKAKSIHTYKEVNLACIEAGDMKLASICAVPVVLKAEEVSGMYNRYESRGMWEELFSVL
KIASSHQGAHMSIFTEMGVLLAKYRPEKLIEHVNMYSKKINTHKMITVCEQYHHWIVLRL
LHINNEDWLAAANLMMHRHADTFDNEIFKEVISHLGASDVVYTAIGFYLRTHPEHLNDFL
SSIFKRVDPERVMEETMRVTPIYVIRAFLETAQERNIKKVNEALNDLYIEEEDFKTLRHS
VETYNNFDSEELSSRLEKMELFEFRKIAMLLHRKNKRYAHAIAAAKENKLFDEAIDTAAE
SADGELVTSLLDYFVKDYPDCFVACLYRCYDLLKPSAVLLKAWLNHRTEVAMPYMIQVLQ
EYSSKIDRMEKSMVDAQVAAKDAARRAGPMQGPSAAPLMIEQGDGMVMNGMPMSRPQPPM
SFGAPPQFGSGRPF
NT seq 5085 nt NT seq  +upstreamnt  +downstreamnt
atgaactctccctcactttctttggaggtctttcaacttaactccgtctcgggtggcctc
cgcccgggttccatcgccttcaaaaatgtcacggtagagagcgagaaatatgtctgcgtc
cgcgatgtgcaggaggacgggcagacatcactcgtcatcgttgatatcgagaagcgtgag
agcattcgaaacaacgtcaaggatgcggagtcgtgtattatgaaccccaggtcgaaaatc
ctggcgctccgcagtggtcgcaacctgcaggtgttcgacgtggaggcctcgcgacgtctc
aaggcgacgcttttccacgacgacgtcgtccactggggctggattgacgaccgtactctg
ggcattgtgacggggaaggccgtctaccactggagcctcgatggcgccgccgacgacgcg
ccgctgcacatcttcgaccgcagcgcggactacgacagctccgtgcaggtgctctcgtac
cgcagcgacgagcagaagaagtggcttctcgtgacaggtgtagcccgcgacccatcgggt
gctatggtgggcaaggcgttgctgtacagcgttgagaaccgcagcagtcgtgtgcttgac
ggtcatgcgtgctgcttcatctccacccccaccccgtccgaatctcgcaagtgtaacgtg
atgtgccttgcctggaacagtccgcagcagggcggccaggtcatgatcatggagttgccg
accggctccaagacagatttgtcgttgccacggcggatttacaacctgcgcattcaaccc
ggcgacttcccagtcgccatgcacgtctcggaccgccacaagttgttgaccgtggtgacg
agccgtggcacctttgcgttgatggacatctttaccggagtcatcgtggccgaacagcag
ttcacgccggcagtagtgttccgtggcgcaggcgacaacaaggttggcggtgtcgtgtgc
gtcaacaaccagggctccgttatgcgcatcggcccgaacgacagcggcatcatcaactat
attaagaacaacatgcaaaaccctgagctggctctgcgcatcgcctccacggcgaacctc
gggggtgtcgatgacctcttcaaagtgcagctggacaactacctgcgcattggcaacatc
gaggaggccacccggatatgcttgcgcgccccggggaacatgctgcgcacccgtgagatt
ctcatgaatttcatgcaaatgccgcagcagccgggccagccgccggctatctcgacctac
ttcaagattgtgctggcggagacgagcctgaacgagtacgagtctgtcgaacttgcgcgc
gcggtggtacccaagggtggcattggctacgtgaagcagcagtttgacgagggaaagctg
acggcctcggaggagctcggcgacatggttcagcaggcggaccccaacatggcgctgaag
attttccaccagggcaacgtccacgccaaggtgctcaacgtgctgctgcagcgcaacgaa
acgcagaaggcggttgagtattgcaagcgatccaacttctcgccggattggcgcgtcatc
gtgaacaacttcatccgggttgcgccacaggacgccgtcaatctttgcctgatgctctac
cgagagatgggcgacaagccggtgctcagcgcggaggagatgatggacatgttcgtgtcg
gcccagcaaattcaacaggcgaccgagttccttctggaggttctgcgcgatcacaacgac
gaatcgacgatggacctgcaaacgaagctgctggagataaacctcaagtactcgcacccg
tccgtcgccgacaagatcttcgtccggaatatttgccagtactacgacggcatgaagctc
gccccgctctgcgagcgggtcggtctgcaccagcacgcgattgagtgctatatgattgct
cagaaacaggaccccaacctcaacaacctctcgagcatccgccgctgcctaaaacagttg
cagagctttaaccctgagtggctcgtcgagttcttcggtaagctcaacaagcaggaaagc
ctcaagtgcctcgaggacctctgcaccaactcgcgccagagcttcaaggtacttgtgcag
gtggccactaagtacagtgacgctctcggctccaccgacctcattggcatgttccttgag
cacaacctgtacgacgtgctctactactatctcggggccgtggtaccgtacacgcgtgat
gccgaggtgcacttccgctacatcgaggctgctgctgagatgggtcaaatgcaggagctg
gagcgcatgacgcgcgagagcccgtgctacgacgccgagcggacgaagaattacctcaag
agcaagaagctgacggacctgtggcccttcatcaacgtctgtgatcagcacaacatggtg
aacgagatggtgcactaccttgtggagacgagcaacgagaactacatcgagcaatacgtg
acgcgccgcagccctggtaagacgccacaggtagtgcaggccctcatcgagtgcaacgtg
agcgaggactttatcacgaacatgctctcagtggtggggacaatgtgccccagtgaggag
ctcgtgcagtgtgtggaggagacgggtcggctacacctcatcaagcagtggctcgaggac
cgtcgcagcgagaagaagacggacaaggcactgtacaatgcgctggccaagatctacgtt
gacattggccagagccccgagcaattcctggcggagaacgagtactacgatgcgttggtg
gtgggtaggtactgtgagacgcgcgaccccaacttggcctatattgcctatagccacgat
cactgcagcaaggagctggtcgacctctgctatcgcaacggcatgtacaagcaactggcc
cgctacctagtgaaggagcaggatcttgacctgtggacgagcgtgctggcagaggacacg
gctcaccggcagcagcttgtagaatcggtgcagcagactgccctgccagagagtgtggtg
agcgaggaggtgagcacgacggtgcgcgccttcatgaacgccaacctgacggaggagctg
accgcgctgctaagccagattgtggtgcacggccgcttccgcaagaaccgcttcctcgag
aaccttcttatcatgtctgcggtgcgttcccgcaaagataaggtgatggagtacgtgacg
acgctggaggactacgacggcgccgacattgcacacctcgcttccggcgccggcatgcat
gaggtggcgtttgtcgtatacacgcgtcacaacatgcagaaggaggccatcaaggtgctt
ttgcaggatatgaacgatgtttcgcgcggccgagcctttgcacagaagacggacactgcc
gctgtgtggtcggtgttgggcgagtacctggtgaagcaggatgaggtgcacgagggtatc
gagtgcctcatcaaggccaagaatcccgacctcgttgtcgaagtgacctctgctgcggag
cgcacgaatcaatacagtgatctcatcaaatacctctcgatggcacgccagtactcacgc
gcaaaggacagcaagatcgacacggcgcttgtcattacgtatgccaagacaggccgcctc
ggggagttggaggagttcctcaagcaggcgcacaacgtcaagattggcgccattgctgac
aagtgcttcgacgagaagctgtacgagtccgcgcgcgtgctgtataccgtggcgaacaac
tacgcccgcctggcgtccacggaagtgatgctgagcaacctgccgaatgccgtcgaggcg
gccaagaaggccaagtcgatccacacatataaggaggtcaatctggcgtgcattgaggct
ggagacatgaagctggctagcatctgcgccgtcccggtggtgctcaaggcagaggaggtc
agcggcatgtacaaccgctacgaaagccgcggcatgtgggaggaacttttctcggtgctc
aagattgcctctagtcatcagggcgcgcacatgtctatcttcaccgaaatgggcgttttg
ctggccaagtataggcccgagaagctcatagagcacgtgaacatgtactcaaagaagatc
aatacccacaagatgatcactgtctgcgagcagtaccatcactggatcgtgctgcgtctt
ctgcacatcaacaacgaggactggctggccgcggccaacttgatgatgcatcgccacgcg
gacaccttcgacaacgagatcttcaaggaagttattagccacctcggcgccagcgatgtc
gtgtacacggcgattggcttctacctcaggacacaccctgagcacctgaacgacttcctg
tcctccatcttcaagcgcgtggacccggagcgagtgatggaggagacgatgagggtgaca
ccgatctacgtgattcgagcctttctcgagaccgcgcaggagcgcaacatcaagaaggtg
aatgaggctctcaacgacctctacatcgaggaggaagacttcaagacgctgcgccactcc
gttgagacgtataacaacttcgactcggaggagctgtcgtcacggctagaaaagatggaa
ctctttgagtttcgtaagattgccatgctgctgcatcgcaagaacaagcgctacgcgcac
gccattgcagccgcaaaggagaacaagctcttcgacgaggccatcgacacggcggccgag
agtgctgacggcgagctggtgaccagcctgctcgactacttcgtgaaggactatcccgat
tgctttgtggcgtgtctctacaggtgctacgacctgctgaagccctcggcggtgttgttg
aaggcgtggctgaatcatcgaactgaggtagcaatgccgtacatgattcaggtgcttcaa
gaatactcgagcaagatcgataggatggagaagtcgatggtggacgcgcaggttgcggcg
aaagatgcggctcgtcgtgccggcccaatgcagggtcccagcgccgcgccactcatgatc
gagcagggtgacggcatggtgatgaacgggatgccaatgagtaggccccagccgccgatg
agctttggcgcgccgcctcagttcggatctgggcggcccttctag

DBGET integrated database retrieval system