KEGG   Leishmania braziliensis: LBRM_35_2500Help
Entry
LBRM_35_2500      CDS       T01113                                 

Definition
guanylate kinase-like protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
lbz  Leishmania braziliensis
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:lbz00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
36:935003..935989
Genome map
AA seq 328 aa AA seqDB search
MSATPKTSTPTISSVAVASSAHKTARQAMEPLKDTVTLSRLVDVLLFLGPSGCGKSTMIQ
RLQRDWPMLFEFSVSHTTRCPRRGEVDGQHYHFITMEEFQKLIDSGAMIEYSRLCLPKTS
STTPPQSQPVGNLYGTSKKALHTVLERNRVVLMDTDLLGAISIRRYCAREVVNVRPVTVS
RSKRSMAQQGGGAAPAAQSPLTLSPSSLAPVLLARERAVAPAGTILSTDATLSSPSYAAP
GVTRTLRCMIIFIAPPSMKVLEQRLRERKSETEASIQLRLKLSCRLMKWATENQSFFDYY
IVNDNLEHCYAQVKEIVQAEVLMLGSSL
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcaactccgaagacatcgacgccgacgatttcatcggttgccgtcgcgtcttct
gcccacaaaactgctcggcaggcgatggagccgctcaaggacactgtcaccctcagccgt
ctcgtggacgtgctcttgtttcttgggccgagcgggtgtggcaagtccacaatgattcag
cgactgcagcgcgactggcccatgctatttgagttcagtgtgagtcacacaacccgttgc
ccgcggcgtggcgaggtagatgggcagcactaccactttatcaccatggaggagttccag
aagctaatcgactcgggtgccatgattgaatactctcgactctgcctgccgaaaacgtcg
tcgacgacgcctccgcagagtcagccagtcggtaatctctacgggactagcaagaaagct
ctgcatacggtgctcgagcgcaaccgcgtcgtactcatggacacagatctgcttggcgca
atcagcattaggcgctactgtgctcgcgaggtggtgaacgtgaggcctgtaaccgtttcg
cgatcgaagcgcagtatggcgcagcagggcggtggtgccgctcccgccgctcagtcccca
ctaaccctctccccatcttctcttgcacctgtgctcctggcacgtgagcgcgccgtggct
cccgcgggcacgattctatccacggacgcgacattgtcgtccccctcgtatgctgcacct
ggggtcacacgcacgctgcgttgcatgatcatcttcattgcgccacctagcatgaaggta
ctggagcagcggctgcgggaacgcaagagtgaaaccgaagcctcgattcagctgcggttg
aagctgagctgccggttgatgaagtgggccacggagaaccagtcattctttgactactac
atcgtgaacgacaaccttgagcactgctacgctcaagtaaaggaaatcgtgcaggcagag
gtgctcatgctggggagctctctctga

DBGET integrated database retrieval system