KEGG   Leishmania braziliensis: LBRM_35_2500Help
Entry
LBRM_35_2500      CDS       T01113                                 

Definition
(RefSeq) guanylate kinase-like protein
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
lbz  Leishmania braziliensis
Pathway
lbz00230  Purine metabolism
lbz01100  Metabolic pathways
Module
lbz_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lbz00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LBRM_35_2500
Enzymes [BR:lbz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LBRM_35_2500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin Rad17 AAA_33 RsgA_GTPase AAA_16 RNA_helicase AAA_29 NACHT ABC_tran Viral_helicase1 MMR_HSR1 AAA_22 AAA_5 Mg_chelatase AAA_18 AAA_28 G-alpha AAA
Motif
Other DBs
NCBI-GeneID: 5419845
NCBI-ProteinID: XP_001568870
UniProt: A4HP95
Position
36:935003..935989
Genome map
AA seq 328 aa AA seqDB search
MSATPKTSTPTISSVAVASSAHKTARQAMEPLKDTVTLSRLVDVLLFLGPSGCGKSTMIQ
RLQRDWPMLFEFSVSHTTRCPRRGEVDGQHYHFITMEEFQKLIDSGAMIEYSRLCLPKTS
STTPPQSQPVGNLYGTSKKALHTVLERNRVVLMDTDLLGAISIRRYCAREVVNVRPVTVS
RSKRSMAQQGGGAAPAAQSPLTLSPSSLAPVLLARERAVAPAGTILSTDATLSSPSYAAP
GVTRTLRCMIIFIAPPSMKVLEQRLRERKSETEASIQLRLKLSCRLMKWATENQSFFDYY
IVNDNLEHCYAQVKEIVQAEVLMLGSSL
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcaactccgaagacatcgacgccgacgatttcatcggttgccgtcgcgtcttct
gcccacaaaactgctcggcaggcgatggagccgctcaaggacactgtcaccctcagccgt
ctcgtggacgtgctcttgtttcttgggccgagcgggtgtggcaagtccacaatgattcag
cgactgcagcgcgactggcccatgctatttgagttcagtgtgagtcacacaacccgttgc
ccgcggcgtggcgaggtagatgggcagcactaccactttatcaccatggaggagttccag
aagctaatcgactcgggtgccatgattgaatactctcgactctgcctgccgaaaacgtcg
tcgacgacgcctccgcagagtcagccagtcggtaatctctacgggactagcaagaaagct
ctgcatacggtgctcgagcgcaaccgcgtcgtactcatggacacagatctgcttggcgca
atcagcattaggcgctactgtgctcgcgaggtggtgaacgtgaggcctgtaaccgtttcg
cgatcgaagcgcagtatggcgcagcagggcggtggtgccgctcccgccgctcagtcccca
ctaaccctctccccatcttctcttgcacctgtgctcctggcacgtgagcgcgccgtggct
cccgcgggcacgattctatccacggacgcgacattgtcgtccccctcgtatgctgcacct
ggggtcacacgcacgctgcgttgcatgatcatcttcattgcgccacctagcatgaaggta
ctggagcagcggctgcgggaacgcaagagtgaaaccgaagcctcgattcagctgcggttg
aagctgagctgccggttgatgaagtgggccacggagaaccagtcattctttgactactac
atcgtgaacgacaaccttgagcactgctacgctcaagtaaaggaaatcgtgcaggcagag
gtgctcatgctggggagctctctctga

DBGET integrated database retrieval system