KEGG   Leishmania braziliensis: LBRM_35_2550Help
Entry
LBRM_35_2550      CDS       T01113                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lbz  Leishmania braziliensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Butirosin and neomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lbz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LBRM_35_2550
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBRM_35_2550
   00052 Galactose metabolism
    LBRM_35_2550
   00500 Starch and sucrose metabolism
    LBRM_35_2550
   00520 Amino sugar and nucleotide sugar metabolism
    LBRM_35_2550
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    LBRM_35_2550
Enzymes [BR:lbz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LBRM_35_2550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
36:947788..949023
Genome map
AA seq 411 aa AA seqDB search
MVQTKEIALEQLALTLTGDASWSSGPIYVVCDVGGTSARVGFSQASQHDRSGLHIIYVRF
KVTKSDIRQLLEFFDEVLQHLKKNLPDHGASFLRRVASGAVSVPGPVTNGQLAGPFNNLK
GIARLVDYPVELFPKGRSALLNDLEAGAYGVLALSNAGILSDYFKVMWKGTQWDALSEGK
PAGSTIGRGRCMVVAPGTGVGSSLIHYVGVSDSYIVLALECGSLSMSWCANEDSKYVQAL
AGYMASKAHAKGLDSTVAPIWEAASNGAGLEFNYAYAKEGQKASAPLKSAPEVAKLAKSG
SDTAAIAAVDRLYKNLIGLTAETTMQFLPLTCVLMGDNVVANSFYFEKPENVKRLQARLH
EHAMERQFKFLSRTTFLRQVSSVNINLLGCLGFGSQLSKSADQVVPTKSHL
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagaccaaagaaatcgcgctcgagcagctggccctgactctcacgggcgatgcc
tcctggtcctccggccccatctacgttgtgtgtgatgttggtggcacgagcgcgcgcgtc
ggtttttctcaagcgtcgcagcacgacagaagtggtctgcacatcatttacgtccgcttc
aaggtgacaaagagcgacattcgccagctgctcgagttcttcgatgaggtgctgcaacac
ctgaagaagaacttgcccgaccacggcgcctcctttctgcgtcgggtggcgtcgggtgct
gtgagtgtgccgggaccggtcaccaacggacaactcgccggccccttcaacaatctgaag
ggcattgcgcggctggtggactacccagtggagctgtttccgaagggccgcagcgcgctc
ctaaacgatctagaggcgggcgcctatggtgtgctagctctgagcaacgccggtatattg
tctgactatttcaaggtcatgtggaagggcacgcagtgggacgcgctgtcggaaggcaag
cccgccggcagtaccatcggtcgcggccgctgcatggttgtggcccccggcaccggtgtt
ggctcctctctcatccactacgtgggtgtctcggacagctatatcgtgctggcgctggag
tgcggctctctgtccatgtcatggtgtgccaacgaggactcgaagtatgtccaggcactt
gctgggtacatggcatccaaggcgcatgcaaagggcctggactcgacggtggccccaatc
tgggaggctgcgtcaaatggcgccggattggagttcaactacgcgtacgccaaggaaggg
cagaaggcatctgcacctctcaagtccgcgcccgaagtggccaagctcgccaagagtggc
agcgacacagcagccatcgccgccgtggaccgcctctacaagaacctcataggcctcaca
gccgagacgacgatgcagttcctaccactgacgtgtgtgctgatgggcgacaatgtcgtt
gccaacagcttctacttcgagaaaccagagaatgtgaagaggttgcaggctcgcctgcac
gagcacgcgatggagcgtcagtttaaattcttgagtcgcaccacatttcttcgtcaggtg
agcagtgtgaacatcaacctgctggggtgccttggatttggtagccagctctccaagtcg
gcagatcaagtggtgccgaccaagtcacacttgtga

DBGET integrated database retrieval system