KEGG   Leishmania braziliensis: LBRM_35_3230Help
Entry
LBRM_35_3230      CDS       T01113                                 

Definition
(RefSeq) putative glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
lbz  Leishmania braziliensis
Pathway
lbz00480  Glutathione metabolism
lbz00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:lbz00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    LBRM_35_3230
  Metabolism of other amino acids
   00480 Glutathione metabolism
    LBRM_35_3230
Enzymes [BR:lbz01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     LBRM_35_3230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 5419918
NCBI-ProteinID: XP_001568942
UniProt: A4HPG7
Position
36:complement(1231606..1232064)
Genome map
AA seq 152 aa AA seqDB search
MASIFTYSAVQGGKTVSLQRYSGYVTLIVNVASRCSFTSTNVEMLNGVQQAYGSRRFTIL
AFPCAQFANQEPLSNAEIAQWCENIGLLFPVFDRVNVKNPSAHPLFRMLRAQQGAPMWNY
TKYLCDRSGVPRRKLEPGCSMDALRQSIESVL
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggcatccatcttcacctatagcgccgtacaaggtggcaagactgtttcgcttcaaagg
tactcgggctatgtgacgctcatcgtgaacgtggcgtcgcggtgtagcttcacctccacc
aacgtcgagatgctgaacggggtgcaacaagcgtatggctcccgtaggtttaccattctc
gcgttcccgtgcgcacagtttgcgaaccaagagccgctcagtaatgccgagattgcgcag
tggtgcgagaacattgggctgctctttccggtctttgaccgggtcaacgtgaagaatccc
tcagcccacccactgtttcgaatgcttcgggcacagcagggggctcccatgtggaactac
accaagtacctttgcgaccgcagcggtgtgccgcgccgtaagctggagcccggctgctcc
atggacgcgctacggcagtctatcgagtctgttttatag

DBGET integrated database retrieval system