KEGG   Leishmania braziliensis: LBRM_35_6620Help
Entry
LBRM_35_6620      CDS       T01113                                 

Gene name
TOR1
Definition
putative target of rapamycin (TOR) kinase 1
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
lbz  Leishmania braziliensis
Brite
Protein kinases [BR:lbz01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   LBRM_35_6620 (TOR1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
36:complement(2424077..2431921)
Genome map
AA seq 2614 aa AA seqDB search
MVSNSGVGSSHGSGGTSSNRHPLIGQLRPIFQELESSAPQTLPSIILKLEYVIEEEKDAL
FHRNSIKSYTANARIFPNWLNAQLRHLFERPQTHMAGVQVLRALLPVEYVELNEMTKLFS
ELLVRCVLETGDYKTALEAGEVWGLLLNNGSSVVEGIINNCLQFSLALLMRGGHDEVFLR
EDVNQRGDDRGATARPGGSPLVDLSRLGENTPLTDEDLFPEATKLSGCIFIQQLVRRVPS
MIAPHVNSILECLRRAILDANKLVRVSGGDALFHTLAISYRSTDPKFYSRWQNRFLEDTE
RSVLYGSDIVLHGCLLAFNAVLSATALREAEGREVGFSNRGRKHILQFWAFVNDNLVSTS
HNGDVRAEVLNALPLLAQYDSITFKEISVKHVRALAEAVFVGTEGTDERAIVFQVLARLF
TVLPSLVVPFLDFMMKYIESSLTPHPLRGRCPEAVTCFATLAGVEPNAVRPFLRHLLGPL
FAGSVTEHFARDVAKICTAFPELRSTCLSKVLEATKAQLLRMRNRPRHARASSETDHSTI
VHNLNSLGSLDFTGYSTLQFLCDAVIRYVSDPHEEVRRSAIDLCFKLVLSGCSQSPCERT
DVGVVIHRGREHVGLVNTVIRKLVSAAVADTESDIRLHTLEHLTAEFDYSLALQSICTAL
FPALHDHHQNRIAATRLLGRLSSRNPSCILPMLRCVMVQCIMDIQLFHAPKRQEQAAVVL
SVVVESAPAMARPYISSLLQDCVMRLQEENKPVPVITALLSLVGKLARYAEGNDVAVVAA
IRPCVIRHILDSSSIQKKIEAIRTLGDIIRTTKYVDVYETNPELLSVLLSALHGSFKETW
PVRLDVLKLMGIIGAIDPVRAKEITRDLRDGGLSSSGAAAPSALQYSSSRGEEAVVQNVV
KNVLGVLQLPSLSDDQCLCAVQVIANTLSLKEAASGCLTPMYRDILQTVLQRITLQAKIR
ENLLRVMTRIVYLYGQHIRPYMGELITTCVDFLPAAERGVLVEILCLLSEMRRSLREEFC
PSLSLVLPPLLQTVQADAAHSSEPVFAFLVDMGHLLDDHLHNVVPCACEVASNPAYPVAC
RAAAVDAIRHFARRLPHLVFHASRCMHCLCRVLREMESHPLLFVHQPRGSADTAHRRPVA
ELAAGGGTAAADVRTFVAVTLDAVRDVSRNLGSDFEKYTPLVFPLLEAYGEDGQEVKSSI
LSTLRTNGCVAAPESTQEQEAEAAARYRVSTQELAQRRKAALEDNFAQLRSVLVARDRVT
EEEWSMWLKQLAVELLRSSPSNAHGFAFALAQLHEPFARHMLHSAFAVCYAEMAPKTKDL
VRTLLGNVLRSDRVPSEVLQELLNLSEYMERLEMRFNPKEGSHSTYAGLLFDLKTLMESS
ERCNLYAKALHYVEIQFYEATYEYERNVMRGQVHPLLPEEWSRLLQWCEKSIYLCNLLGL
RESAEGMLKYIQRNFSFLTGKPPSELPLMMDAQLLEKLQWWSQSLRAYEKGLQEEPNKFS
NMVGFMRSLDNLGDYGRLLESWKLFHPHITRKEASELAPYGAHAAWLLRCWEDMEKITAY
MTDDGYIGTTAVFYRAVLATHKLQFHDAVPLIQNCRKRLDSTLSALVAESYDRAYGLFVG
IQQLSELEELAFVSVNPQGLNHWQELWEKRLAAMAYEGWPGTLANHTLVIPLGQELEMWL
RFVSLSRVHGRDRTSRDILFELLGKRSIAAALEQPRLPQPPIALATCQHFYDINERERAV
ELLETYLKKMDQAAPSLPDTGDSQASLAMCHAKLASWLFTVAKKKRHNMDAHYREYIRHH
LEKATSLDSTNGRIWHTWARFNHDLVTHRSRGAASDVRRDEYVEHIVAAMDGYVRSVSFS
QELEDMLGFLSLWFIHAALPQVQDNVTLQAEILQVSPTVWLKVIPQIIARLHSRDAVVSE
SVFQLLTIVAKAHPQALLYSLNVTLNSSVRSAESNTAEQMERKQAAQRLLGRIKEMHNNG
RMMVKDAALVCQELVRCAVLWTELWFDELERAWFQWGRDKNAHSVLLALQPLLEHLSHPD
TLAESHFVTEFGDLLSGACECVEKALSTGNNVYMEEAWNRFKTAVKRMDEQINGMTSLAL
QLVSPRLIQSGKDLSLVVPGQYSDTGVYPHISSFQSTLKVMNSKQHPRRLYMTGTDGVLY
KFLLKGHEDLRLDERVMQLLAFVNTLLEKHSAIQRRDCMIQVFSVTPLSENAGLVGWVDN
CDTLHQLIKDYRVHSKYLSIEVNLMLSFNVDLDRLQVIQHVEPFEFALEQTEGADLANSL
WMRAPSAESWLDRRTTYVCSLATMSMVGHILGLGDRHPSNLMIHSFSGRVVHIDFGDCFD
VAQNRSAFPEKVPFRLTRMLVKAMEMGGIDGLFRHGCITVMGVLREEGSSILALLEAFVH
DPLVSWWRDESEDGAVASAVVASAAPSSSMPSIAAPAPLSHYSQRAAYAAIGESFHKSRT
AFPSLTPASRLSVSCGRSLRAPQASVASRVRASPPLVSSSQSSDILSNMSVNHTSEAKKV
VNRIREKLEGREFAGWQLQANALSHAAGGVGVAMKEGAGEEPMTSARLGSDASAAPMASG
EDGLSVQAQVTRLISEATSNENLCVHFQGWCPFW
NT seq 7845 nt NT seq  +upstreamnt  +downstreamnt
atggtgtccaatagcggcgtaggcagtagccatggcagcggtggtacgagcagcaatcgg
catccgctgattggtcagctgcggcccatttttcaagagctagagtcgtctgcgccgcag
acgttgccttccattatcctcaagctagagtacgtgatcgaggaagagaaggacgcgttg
tttcaccgcaactccatcaagtcctatacggccaacgcacgcattttcccaaactggctg
aatgcgcagctgagacacctgttcgagcggccgcagacgcacatggcgggcgtgcaggtg
ctacgggcgttgctaccagtggagtacgtggagctgaatgaaatgacgaagctcttttcg
gagctgctggtacgctgcgtactagagacgggggactacaagacagccttggaagctggg
gaagtgtggggactgctgctcaacaatggcagcagtgtagtggagggcatcatcaacaac
tgcttacaattttcgttagccctgctgatgcgcggagggcacgatgaggtatttctgcgc
gaggacgtgaaccagcgcggcgacgacagaggagcgacggctcgaccgggcgggtcccct
ttagtggacctttcacggctgggcgagaacactcctctcacggatgaggatctgttcccc
gaggcaacaaagttgtcggggtgcatcttcattcagcagctggtgcgccgcgtgccgtca
atgattgcgccgcatgtaaacagcattcttgagtgcctgcgccgtgccatccttgacgct
aacaaacttgtgcgagtgagcggcggtgatgcgctctttcacacgctagccatctcctac
cgctcaaccgaccccaagttctacagtcgttggcagaacagattcctcgaagacacggag
cggagcgtcctgtacggaagcgacatagttttgcatggatgcctgttggcctttaatgcc
gtgctctccgccacggcgttgcgtgaggcggaagggcgagaagtcggcttctccaatcgg
gggcgcaaacacattctgcagttctgggcgtttgtcaatgacaaccttgtgagtacctcc
cacaacggcgatgtgcgcgccgaggtgctcaacgcattaccgctgctggcacagtacgat
agcatcaccttcaaggagatctcggtgaagcatgtgcgcgcgctcgcggaggcggtgttc
gttgggactgaaggcacagatgagcgggcaatagtgtttcaggtacttgcgcgactcttc
acggtgctgcctagcctcgtcgtaccgtttctggactttatgatgaagtacatcgagtcg
tcgttaacaccgcaccctctccgtggccgctgccctgaggctgtgacgtgcttcgccacg
ctcgctggcgtagagccgaatgcggtgcggccctttctgcgacatctgctggggccactc
ttcgctgggtcggtgacggagcactttgcgcgcgatgtagcgaaaatctgcacagccttt
ccagagctgcggtcgacgtgcttgtccaaggtactggaggcgaccaaggcgcagctgcta
cgcatgcgcaaccgacctcgacacgcccgtgcgtcaagcgagacggatcacagtacgatt
gtgcacaacctcaactctctcggaagtcttgacttcactggatattcaacgctgcagttc
ctgtgtgacgccgttattcggtacgtatccgatccacacgaggaggtgcgccgaagtgcg
atcgatctgtgcttcaaactggtcctctccggctgctctcagtcgccatgcgagcgcact
gacgtcggcgtcgtgattcaccgcggccgggaacacgtggggctggtgaacactgtcatc
cggaaacttgtaagtgcagctgttgctgacaccgagagtgatatccgtctgcacacactg
gaacacctcaccgcggagtttgactactcactggccttgcagagcatctgcacggcactg
ttccccgccctacatgaccatcatcagaaccgcatcgccgccactcgtctcctgggccgc
ctttccagtcgaaacccatcatgcatcctccctatgctacgttgtgtgatggttcagtgc
attatggacattcaacttttccacgcaccgaaacggcaggagcaggcggcagtggtgctg
agcgtggtggtggagtccgcccctgcgatggcgcgcccgtacatctcgtctttgctgcag
gactgcgtgatgcggctacaggaagagaacaaacctgttccggtgatcacggcacttttg
tcgcttgttgggaagctcgcgcgttacgcggagggcaacgacgtggcggtggttgccgcc
atccgaccctgtgttattcggcacatccttgactcgtccagcatccagaagaagatcgaa
gccattcgcactctgggagacatcatccgcaccacaaagtacgttgacgtgtacgagacg
aatcctgagttgctgagcgttcttctctccgctctccacggcagcttcaaagaaacgtgg
cccgtgcgactggatgtgctgaagctgatgggcattattggcgccatcgatccggttcgt
gccaaggagatcacgcgggacttgcgggacgggggcctgagcagcagcggcgcggctgca
ccttccgcattgcagtattcttcctctcgcggcgaagaggcggttgtgcagaacgttgtg
aagaacgtactcggcgtcctgcagctgccatccttgtcggatgaccaatgcttgtgcgct
gtgcaggtgattgcgaacacgctgtcactcaaggaggcagcgagcgggtgtctgaccccg
atgtaccgcgacatactacagactgttcttcagcgaattactcttcaggctaagatacgc
gagaacttgctcagggtaatgacgcgcatcgtgtatctatacggccagcacattcgtccg
tacatgggcgagctcatcaccacgtgcgtcgacttccttcccgctgcggagcgcggcgta
cttgtggagatactgtgtctgctgagcgagatgcgccgctcgctgcgtgaggagttctgc
ccgtcgctctcgctggtgttgccgccgctcctccagacggtgcaggcggacgccgcgcac
tccagcgagcctgtgtttgccttcctcgtcgatatgggacatttgcttgatgaccacctc
cacaacgttgtgccgtgtgcctgcgaggtggcaagtaaccctgcctatcctgtggcatgc
cgtgcggcggctgtggacgccattcggcactttgctcgtcgactgccgcaccttgtgttc
cacgcatcgcgctgcatgcactgtctgtgccgggtgctgagggagatggagtcgcatccc
ctgctgtttgtgcatcaaccacgagggtctgcggatacggctcatcgccgccctgttgcc
gaactggcggctggtggaggcacggcggctgcggacgtgcgtacctttgtcgctgttact
ctggatgcagtgcgcgacgtgagccgaaacctcggtagcgacttcgagaagtacacccct
ctggtgtttccactgctggaggcctacggcgaggacgggcaggaagtaaagtcgtctatc
cttagtaccctacgcacgaacggctgcgtggcggcacccgagagcactcaagagcaagag
gccgaggctgccgctcggtatcgcgtcagcactcaggagctggctcagcggcgcaaggct
gcgctggaggataactttgcgcagcttcgcagcgtccttgtcgcacgcgaccgagtgacc
gaggaggagtggagcatgtggctgaaacagctggcagtggagctgctacggtcgagtccg
tcgaacgcgcatggcttcgcctttgcccttgctcagctgcacgagccctttgcgaggcat
atgctgcactccgccttcgctgtatgctacgctgaaatggcgccgaagacgaaggatctg
gttcgcactcttctcggcaacgtacttcgcagcgaccgcgtgccgtcagaagtgctgcag
gagctgctgaacttgtcagagtatatggagcgactggagatgcgctttaaccccaaagag
ggctcacacagcacgtacgccgggcttctgtttgatttgaagacgctgatggagagcagc
gagcggtgcaatttatacgccaaggcgctgcactacgtcgagattcagttctacgaggca
acgtacgagtacgagcgcaacgtgatgcgcggtcaggtccacccactgctgccggaggaa
tggagtaggcttctacagtggtgtgagaagagcatctacttgtgcaatctgctaggactg
cgcgagagcgcggagggcatgctgaagtacattcagcgcaacttttcttttctgaccggc
aagcccccgtcagagttaccactcatgatggacgcgcagctccttgagaagttgcagtgg
tggtcgcagagtctgcgggcgtatgagaagggtctgcaggaggagccgaacaagttcagt
aacatggttggtttcatgcgctctctcgacaacctcggcgactatggtcgactactggag
tcatggaagctattccaccctcacattacgcgtaaggaggcctctgagctggccccatac
ggtgcccacgcggcgtggctgctgcggtgctgggaggacatggagaagatcacagcctac
atgaccgatgacggctatattggcacgactgccgtcttttaccgtgccgtgctcgccact
cacaagcttcagttccacgacgccgtgccgctaattcaaaattgccgcaagcgactcgac
tcaacgctgtcggcactcgtcgcggaaagttacgaccgcgcctacggtctgtttgtcggt
attcagcaactgagtgagctggaggagctcgcatttgtctccgtcaatccgcaaggcctc
aaccactggcaggagttgtgggagaaacggctggctgccatggcctatgaaggctggccc
ggtacacttgctaaccacacgcttgtcattccactggggcaggagctggagatgtggctg
cggtttgtgtcgctctcgcgcgtgcacggccgcgaccgcacatcgcgcgacattctgttc
gagcttctgggcaagcggagcatagcggccgcgctggaacagccgcggctgccgcaaccc
cccattgccctcgctacctgccagcacttctacgacattaacgagcgcgaaagggcggtc
gagctacttgagacgtacctgaagaagatggaccaggcggccccctcgctaccggacacc
ggggacagtcaggcgagcctggccatgtgtcatgcaaaactggcgagctggctcttcacc
gtggcgaagaagaagcggcacaatatggacgcgcactatcgcgagtacatccgtcaccac
ctcgagaaggcgaccagccttgacagcactaacggtaggatttggcacacatgggcgcgt
ttcaaccacgaccttgtcacacatcgttcccgcggtgcggcgagcgatgtgcgccgcgac
gagtacgttgaacacatcgtggctgccatggacggctacgttcggagcgtgtctttttct
caggagctcgaggacatgctagggtttctctccttgtggttcattcatgccgcgctgccg
caggtgcaggacaacgtgacgctgcaggcggagattctccaggtgagtccgacggtgtgg
ctcaaggttattccgcaaatcatcgcccgcctgcactcgcgcgacgcagttgtgtcggag
tccgtctttcagctgctcaccattgtcgccaaggcgcacccgcaagcgctcttgtacagc
ctcaacgtgacgctgaactctagcgtgcggagtgcagagagcaacacagcggagcagatg
gagcgcaagcaggcggctcagcggttgcttggccgcatcaaggagatgcacaataatggc
cgcatgatggtcaaagacgctgcccttgtctgccaggaactcgtgcggtgcgctgtgctc
tggacagaactttggtttgacgagctcgagcgagcatggtttcagtgggggcgcgacaag
aacgcccacagcgtgcttcttgcgcttcagccgctgcttgagcatctgtcgcaccccgat
acacttgccgagtcgcactttgtgaccgagtttggcgacttgctcagcggcgcctgcgag
tgcgtcgagaaggctttgtcgaccggaaacaacgtctacatggaggaggcgtggaaccgc
ttcaagacggcggtgaagcggatggatgaacagatcaacggcatgacgtccctcgccctt
cagctcgtgagcccgcgtctgattcagagcggcaaggacctgtcactggtggtgccgggg
cagtacagcgataccggcgtgtacccgcacatctcctcctttcaaagcacgctgaaggtg
atgaactccaagcagcacccgcgtcgcctctatatgaccggcacggacggcgtcttgtac
aagtttctcctcaaaggccacgaagacctgcggctcgacgagcgcgttatgcagctgctg
gctttcgtgaacacactgctggagaagcactcggctatccagcgccgcgactgcatgatc
caggtcttctccgtcacccctctcagcgagaacgctgggctggtggggtgggtcgacaac
tgcgacacactgcatcagctcatcaaggactaccgtgtgcactccaaatacctctcgatc
gaggtgaatttgatgctgagcttcaacgttgacctggaccggcttcaggtgatccaacat
gtggagccgttcgagttcgcgttggagcagacagagggcgccgacctcgccaactcgctc
tggatgcgcgcgccaagcgctgagtcgtggttggaccgccgcaccacgtatgtctgttca
cttgccaccatgtccatggttggtcacattctgggcctcggggaccgtcatccatcgaac
ctaatgatccactccttcagcggtcgcgtcgtgcacatcgactttggcgactgcttcgat
gtggcgcagaaccgaagcgcattcccagagaaggtgccattccgactgactcgaatgctg
gtcaaggcgatggagatgggcggcatcgacggacttttccgccatggttgcatcacggtg
atgggcgtactgcgtgaggagggcagcagtattctggcgctgttggaggcgtttgtgcac
gaccccctcgtgtcgtggtggcgcgatgagtcggaggacggggcagttgcatctgctgtc
gtcgcgtcggcagcgccgagcagcagcatgccgtctatcgccgcaccggcaccactcagc
cactactcgcagcgcgccgcctacgcggctatcggggagtcctttcacaagtctcgcact
gcctttccctctctcacgccggcatcgcgcttgtcggtgtcgtgtggtcgctccttacgc
gccccacaggcttcggtcgcttcccgcgtgcgtgcttcacctccccttgtttccagcagc
cagtcgtcagatattttgagcaacatgtcagtcaaccacaccagcgaagcaaagaaagtg
gtcaatcgcattcgcgaaaagctcgagggccgcgagtttgctgggtggcagctccaagcc
aacgccttgtctcacgcggcaggtggcgtgggtgtggccatgaaggagggggcgggggag
gagccgatgaccagtgctcgcttgggcagcgacgcgtcagcagcaccaatggcgagcggc
gaagacgggctttctgttcaggcgcaggtgactcggctcatctcggaggccacctccaac
gagaacttgtgtgtccactttcaaggctggtgcccgttctggtga

DBGET integrated database retrieval system