KEGG   Leishmania braziliensis: LBRM_35_6910Help
Entry
LBRM_35_6910      CDS       T01113                                 

Definition
putative protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
lbz  Leishmania braziliensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
36:complement(2543896..2544675)
Genome map
AA seq 259 aa AA seqDB search
MAWRCSSTTNAGMVSALQREGLLKTPEVIEVMRRVDRGWFVHNCKEAYSDQPLPIGFGVT
ISAPHMHAMMLELVNSSVLCRRNPNQDYRQPLRLLDIGSGSGYITAAFAALCETTRRDGV
PLLFEVIGVEHVQELQEQSKRVIESHFPEWIREHRVKVLHGDGRRPRSIAGVCADKDADF
DVIHVGASAPKALVPEYLHLLRCGGTLVIPVGGPTEVQELQVFTKDAEGGVKMQHACHVR
FVPLTSIHAQLDGDVEMHT
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggcgctgctcgtccacgacgaatgcgggaatggtgagtgcactgcagcgcgag
ggcctcctcaagacccccgaagtgatcgaagtgatgcgccgcgtggaccgtggctggttt
gtgcacaactgtaaggaggcgtacagcgaccagcctctgcccatcggcttcggtgtcact
atcagtgctccacacatgcatgctatgatgttggagcttgtgaactcgtctgtgctatgc
cgccggaacccgaaccaagactatcgccagccgctgcggctgctggacatcggtagtggt
agcggctacatcacggcagcctttgcggcgttgtgtgagacgactcggcgagacggtgtg
ccgctgttgtttgaggtgattggtgtcgagcacgtgcaggagctccaggagcaatccaag
cgtgtcatcgagtcgcactttcccgaatggatccgcgagcatcgcgtcaaggttctacac
ggtgacgggcgaaggcctcggtccattgcgggcgtctgtgcggataaagacgccgacttc
gacgtcattcacgtcggggcttccgcgccgaaggctcttgttcccgagtacttgcacctt
ctccggtgcggcggcacccttgtgattcccgttggtggcccgacggaggtgcaggagtta
caggtgttcacaaaggacgctgaaggcggtgtcaagatgcagcacgcgtgccacgtgcgg
tttgtgccactgacatcgatacatgcccagctggatggcgatgtggagatgcacacgtaa

DBGET integrated database retrieval system