KEGG   Lactobacillus casei ATCC 334: LSEI_0074Help
Entry
LSEI_0074         CDS       T00407                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lca  Lactobacillus casei ATCC 334
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LSEI_0074 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LSEI_0074 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LSEI_0074 (trpA)
Enzymes [BR:lca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LSEI_0074 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(69905..70699)
Genome map
AA seq 264 aa AA seqDB search
MSKLADVFKNLKVFIPFIVADDPDFETTVKNVVALAKGGADIVELGIPFSDPVADGPVIQ
AADLRAFAANVRTKTVFDIVEAARKETAVPIVFLTYLNIVFKYGYEAFLKRCADLNVAGL
VIPDLPYESRDEIVPIAEKYGIDIIPLITPTSGHRIEKIAKSASGFIYVVSSMGITGERD
EFFAGLKALVAEIKQYTNVPTAIGFGIHTPEQAQTMAGIADGVIIGSAIVDLVAKEKQQA
PAAIEKFTKQIRVAVDAKKQISVK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagttagcagatgtttttaaaaatcttaaagtctttattcccttcatcgtcgct
gatgatcccgattttgaaaccaccgtcaaaaacgtggtcgcacttgccaaaggtggcgcc
gatattgtggagttaggcatccctttttccgatccagtcgccgacggtcccgtgattcaa
gccgccgacctaagagcattcgccgccaacgttcgcaccaaaacggtctttgacattgtg
gaggctgcccgcaaagaaaccgcggtgccaatcgtcttcctaacttacttgaacattgtc
ttcaaatacggctacgaagccttcttaaaacgctgtgcggatttaaatgtcgccggcttg
gtgatcccagatctgccgtatgaaagtcgcgatgaaattgtgccaattgccgaaaaatac
ggtatcgatattattccgttaatcacgccaacttccggtcatcgaattgaaaaaatcgcc
aaaagtgcctcaggatttatctatgtcgtttcctcaatgggcattactggcgaacgcgat
gaattctttgctggcttaaaggcattagtcgcagaaattaagcagtataccaacgttcca
accgctatcggtttcggcattcacacgcctgaacaagcacaaacaatggcaggcatcgcc
gatggtgtcatcatcggcagcgccatcgttgatcttgtcgcgaaggaaaaacaacaggca
ccggctgcgattgaaaagtttactaagcagatccgagtggccgttgatgctaaaaagcaa
atttcggtgaaataa

DBGET integrated database retrieval system