KEGG   Lactobacillus casei ATCC 334: LSEI_0075Help
Entry
LSEI_0075         CDS       T00407                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lca  Lactobacillus casei ATCC 334
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LSEI_0075
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LSEI_0075
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LSEI_0075
Enzymes [BR:lca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LSEI_0075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(70692..71912)
Genome map
AA seq 406 aa AA seqDB search
MKTLNETTQQSTRAGRYGKDFGGQYIPETLMTELEKVTKAFNDLKDNPEFKAELNDLLVN
YANRPSLLYYAKNMTEDLGGAKIYLKREDLNHTGAHKINNVIGQALLAKHLGKKRLIAET
GAGQHGVATATIAALMGMDCEIFMGKEDTDRQKLNVYRMELLGAKVHPVTSGSMVLKDAV
NATLQEWASRSDDTFYVLGSAVGPAPFPEMVKHFQSVISTESKQQLQAKEARLPDMVVAC
VGGGSNAIGSFAAYIDDPSVQLVGVEAAGKGVDTDRTAATIERGSVGIFHGMKSLFMQNE
DGQIDPVYSISAGLDYPGVGPEHAALAQEGRAQYVGITDDEAVEAFTYIAKQEGIVAAIE
SCHAIAYVEKIAPQMAKDQIIICTLSGRGDKDVASIAKYKGVDVDE
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaagacattaaatgaaacaacccaacagtcaacacgcgccggtcgttatggaaaagac
tttggcggccagtatattcctgaaaccctcatgaccgagcttgaaaaagtaactaaggct
ttcaatgacttaaaagataatcctgaatttaaagcagaattaaatgatctattggttaat
tacgccaatcgcccctcgttgctttattatgccaagaacatgaccgaagaccttggtggc
gccaaaatctacttaaaacgggaagatttaaatcataccggtgcacataagatcaataat
gtcatcggtcaggccttgcttgccaaacatttaggcaaaaagcgcctgattgctgaaacc
ggtgccggtcaacatggtgtcgctaccgccaccattgccgcactcatggggatggactgt
gaaattttcatgggtaaagaagacactgaccgccaaaagttaaacgtttatcgcatggaa
cttctcggcgcaaaggttcatccagtcacaagcggatcaatggttttaaaagacgcggtt
aacgccacactgcaagaatgggcgagtcgcagtgatgacactttctacgtgttaggttct
gcagtcggccctgcgccgttccccgaaatggtgaaacattttcaaagtgtcatttcaacg
gaatcgaaacagcaacttcaggccaaagaagctcggctgccagacatggtcgttgcctgt
gtaggtggtggcagtaacgccattggaagttttgccgcttatattgatgatccttctgtt
caattagtcggcgttgaagcagccggtaaaggcgttgataccgacagaaccgccgcaact
atcgaacgcggctccgttggcattttccacggcatgaagtccttattcatgcaaaatgaa
gatggccagattgatccggtatattccatttctgccggccttgattaccctggcgttggc
cctgagcatgccgctctcgctcaggaaggccgggcacaatacgttggcattaccgacgac
gaagcagttgaagcgtttacctacattgcgaaacaagaaggtattgtggccgcgattgaa
agctgtcacgccatcgcctacgttgaaaagattgccccacagatggcaaaagatcaaatc
attatctgtaccttgtccggacgtggcgataaggacgtcgcaagcattgccaaatacaaa
ggagtcgatgttgatgagtaa

DBGET integrated database retrieval system