KEGG   Lactobacillus casei ATCC 334: LSEI_0077Help
Entry
LSEI_0077         CDS       T00407                                 

Gene name
trpC
Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lca  Lactobacillus casei ATCC 334
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LSEI_0077 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LSEI_0077 (trpC)
Enzymes [BR:lca01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     LSEI_0077 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(72523..73305)
Genome map
AA seq 260 aa AA seqDB search
MILDDLVAVTKIRLARHQRQQSLADLKQTVAKMPRNHKPDFLTRLKQPGLHVIAEVKKAS
PSKGTIVTDFPYLAIAKAYDQAGADAISVLTEPDYFNGHLHYLKEISQQVSVPTLRKDFT
IDPYMIYEAKANGAVIILLIVAILTDQQLRDYRQLAEKLGMHAIVEAYTAAEVTRALQSG
AKIIGINNRNLKDFRVDFNNSLKLRAMVPDNIPVVAESGIKTQEDVEKLAAAGFNAILIG
ETLMRSNQKRQLIAAFKERA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgatcttagatgatctggtggctgtgaccaaaattcgtttagcgcgtcaccaacgccaa
cagtcacttgctgatttaaaacaaaccgtggccaaaatgccgcgcaatcacaagccggat
tttctaacacgcttaaaacaacctggcctacacgtgatcgctgaggtcaaaaaggcctcg
ccatcaaaggggacaattgtcacagattttccctacttggcgatcgccaaagcgtacgat
caagccggtgccgatgctatctcggtcttgaccgaacccgattatttcaacggccacctt
cattatctaaaggagatcagccaacaagtgtcggtgccaacgcttcgaaaagattttacg
attgatccttatatgatctacgaggctaaggcaaacggggctgtcattattttactgatt
gttgcgatcctaaccgatcagcaattgcgcgattatcgccaactggctgaaaaactcggt
atgcacgcaattgtcgaggcctatacagccgctgaggtcacacgggcactacagtcaggt
gcaaagataatcggcattaacaaccggaatctcaaagactttcgagttgatttcaacaat
agtttgaaattaagagccatggtgcccgacaacatccccgtcgttgcggaaagcggcatt
aagacgcaggaagacgttgaaaaactggcagcagctggcttcaatgccattctcatcggt
gaaacactcatgcgatctaaccaaaagagacaattaattgcagcatttaaagaaagagcg
tga

DBGET integrated database retrieval system