KEGG   Lactobacillus casei ATCC 334: LSEI_0174Help
Entry
LSEI_0174         CDS       T00407                                 

Definition
phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
lca  Lactobacillus casei ATCC 334
Pathway
Pentose phosphate pathway
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:lca00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
174066..176447
Genome map
AA seq 793 aa AA seqDB search
MDTKVKTVDYSSKEYFDKMTAYWRAANYISVGQLYLKDNPLLERPLKSEDVKPHPIGHWG
TIAGQNFIYTHLNRVINKYDLNMFYIEGPGHGGQVMVSNSYLDGSYSEIYPRVSQDKEGM
KNLFTQFSWPGGVASHASAQTPGSIHEGGELGYALSHATGAILDNPEVIAAVVTGDGETE
TGPLAASWFSNTFINPITDGAILPIVHMNGFKISNPTILSRKSDEDLDKYFSGMGWKPFF
VEGDDPEKLNPEMAKVLDEAIEDIKAIQKHARETGDTTMPHWPVIIFRSPKGWTGPKSWN
GEPIEGSFRAHQIPIPVDAEDMEHADSLAGWLKSYHPEELFDENGKLIPELAALPPKGEQ
RMAANPITNGGIDPKPLVLPDYRKYALDNKEHGKQIKQDMIVWSDYLRDLIKLNPHNFRI
FGPDETMSNRLYSLFEVTNRQWLEPIKEPADQYLAPAGRIIDSQLSEHQAEGFNEGYTLT
GRHGLFTSYEAFLRVVDSMLTQHFKWIRKAHEEPWHKAYPSLNVVSTSTSFQQDHNGYTH
QDPGILTHMAEKKAEYIREYLPADANSLLAISPKLFSSQNTVNVLITSKQPRPQFYSIDE
ATVLANSGLKRIDWASNDDGVEPDVVIAAAGTEPNMESLAAINLLHDAFPDLKIRFINVV
DLLKLRSPEIDPRGLSDAEFNSYFTTDKPILFAYHGFEGLIRDIFFTRPNRNVLIHGYRE
EGDITTPFDMRVLNELDRYHLAKDVIQHVPAYAEKAAAFVQKMDDTLQYHHDFIRANGDD
IPEVQEWTWKPIK
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atggatacaaaagtaaagactgttgattactcatccaaggaatactttgacaagatgacc
gcttattggcgggcagccaactatatttcagttggtcaactttatttgaaggacaacccg
ctgctggaacggccactgaagagcgaagacgtcaagccgcatccgatcggccattggggc
acgattgctgggcagaacttcatttatacccacttgaaccgggtgatcaataagtatgac
ttgaacatgttttatattgaaggcccgggtcatggcggccaagtgatggtttccaattcc
tatctagacggttcgtattcggagatttatccgcgtgtgtcgcaggataaagaaggcatg
aagaacctatttacgcagttctcatggccaggtggcgttgcttcacatgcgagtgcacaa
acgccaggttccatccatgaaggtggcgaattaggttatgctttgagtcacgcaaccggc
gcgattcttgataatcctgaggtcatcgcggcggttgtcacgggtgatggtgaaactgaa
accggcccattggctgcatcatggttcagcaatacgttcattaacccaatcacggatggc
gcgattttaccgattgtgcatatgaacgggtttaagatttccaacccaactatcttgtca
cgtaagtcagatgaagatctagacaaatacttcagtggtatgggttggaagccattcttc
gttgaaggcgatgatccagagaagctgaatccggaaatggctaaagttttggatgaagca
attgaagacattaaggccattcagaaacatgcacgtgagactggcgacaccacgatgcca
cactggccagtgattattttccggtcaccaaagggctggacaggcccgaagagttggaat
ggcgaaccaatcgaaggttccttccgtgcgcaccagattccgattcctgtcgacgctgaa
gacatggaacacgctgattccttggcaggctggctgaagtcctaccatccagaggaactg
ttcgatgaaaacggcaagttgatccctgaattggctgcattgccgccaaagggtgagcag
cggatggctgctaacccaattacgaacggtgggattgatccgaagccgttggtattgcca
gattatcgcaagtatgcgctggacaacaaggaacacggcaagcagattaagcaagacatg
atcgtgtggtctgattatctgcgtgatttgatcaagctgaatccgcataatttccggatc
tttggccctgacgaaaccatgagtaaccggttgtatagcttgtttgaagtgaccaaccgt
caatggctggaaccaatcaaggaaccggctgaccaatatttggcaccggctggccggatt
attgactcgcagttgtccgaacatcaggcggaaggctttaacgaaggctacacgttgacc
ggccgtcatggcttattcaccagttacgaagctttcctccgggtcgtcgattccatgctc
actcagcacttcaagtggattcggaaggcacatgaagaaccatggcataaggcttatcca
agtctgaacgtggtctcaacatcgacttccttccagcaggatcacaatgggtacacccat
caggacccaggtattttgacacacatggctgaaaagaaggctgaatacattcgcgagtat
ctaccagctgatgccaacagcttgctggccatttctccgaagttgttcagctcacaaaat
accgtgaacgtgctcatcacatccaagcagccgcggccacagttctatagcattgatgaa
gccactgttttggctaattccggcttgaagcggattgattgggcttccaatgatgatggc
gtcgaaccagatgttgtcattgccgctgccggaaccgaaccaaacatggaaagtcttgct
gccattaacttgctgcacgacgccttcccagatttgaagattcgcttcattaacgtggtt
gacctgctgaagctgcgcagtccggaaatcgatccgcgcggtttgagtgatgctgaattc
aacagctacttcaccaccgacaaaccgatcctcttcgcttatcatggctttgaagggttg
attcgcgacatcttcttcactcgcccgaatcgcaatgtgctgattcacggctatcgtgaa
gaaggtgacattaccacaccatttgacatgcgggtactcaacgaacttgaccgttaccac
ttggccaaggatgttattcagcatgtgccagcctacgctgaaaaggctgccgcgtttgtt
cagaagatggatgataccttgcaatatcatcatgacttcatccgcgcaaacggcgatgat
attccagaagttcaggaatggacctggaaaccaatcaagtaa

DBGET integrated database retrieval system