KEGG   Lactobacillus casei ATCC 334: LSEI_0291Help
Entry
LSEI_0291         CDS       T00407                                 

Definition
lacto-N-biosidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
lca  Lactobacillus casei ATCC 334
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lca00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LSEI_0291
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    LSEI_0291
Enzymes [BR:lca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     LSEI_0291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
292974..294683
Genome map
AA seq 569 aa AA seqDB search
MKKHGFRFWLLAIVGLLGMVLSLSQPPKQVAAADNTLKSVFSIDAGRKYFSADQLKTIID
RAHTDGYTDVQVLLGNDALRLLLDDMSVTINGKTYGSDVVKQAIQAGNKAYYDDPNGNAL
TQADMDAVLKYAAARDINIIPVINSPGHMDAILTAMAQLGIKNPAFNGSKRTVDLNNDTA
IAFTKALLQKYVMYFKGHATTFNFGSDEYANDVDTGGWAKLQQSGTYKKFVAYVNDLAAM
AKNAGLKPMVFNDGIYYDNNTSFGTFDKDLIVSYWTAGWGGYDVAKPEFLTDKGLKIMNT
NDGWYWVLGRVDGDLYSYKTALASLASKKFTDVPGASSAVPIIGSVQAVWADDPSAQLDM
PALLKLMDQFSTAYAPYLVRPADYSKVDAAIAAVPRQLNQYTEASVAKLDAALNAVVRGK
KATDQALVDGYAQTITVAIKALQLRPADYTKVDAAIAAAKKLDRSHYQDLSAVDAALAAV
NRNLNITQQAQVDTMAAKITAAIAALVLKPVPQPDPRQQQVPTKTIVNPDRYLPKTAEAS
GWELMLAGLATIFGVISIVFFWRQHRMAI
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaagcacgggtttcgattttggttactggcgattgttggactgctgggtatggtg
ttgagtctgagtcagccgcccaagcaggtagctgctgctgataacaccttgaaaagcgtt
ttttcgattgatgcgggacgaaagtatttttccgcggatcagttgaaaacgatcattgat
cgggcacatacagacggttacaccgatgtgcaggttttattgggcaacgatgcattgcga
ttgctacttgatgacatgagcgtgacgatcaatggcaaaacatatggcagtgatgtcgtg
aaacaggccatacaggctggtaacaaagcgtactacgatgatccaaacgggaatgcgttg
acgcaagccgacatggatgcggtcttgaaatatgcagcggcacgggatatcaatatcatt
ccggttatcaatagtcccggccatatggatgccattttgacggcgatggcgcaactaggc
attaagaatcctgcctttaatgggtctaaacggactgtcgatcttaacaatgacactgcc
attgccttcacaaaagcactattgcagaagtatgtgatgtatttcaagggtcatgctacg
accttcaactttggcagtgacgagtatgcaaatgatgtcgatactggtggctgggccaag
ttgcaacaaagtggcacctacaaaaagtttgtggcatacgtcaacgacttagcggcgatg
gccaaaaatgccggcctgaagccgatggttttcaatgacgggatttattatgacaataac
accagtttcgggacttttgacaaggatttgatcgtctcttattggacagctggctggggc
gggtatgatgtcgcaaagccagaatttttgaccgataagggtttgaaaatcatgaatacc
aatgacggttggtattgggttttaggtcgcgtggacggcgatctctatagttacaaaacg
gcgctagctagtttagcaagtaaaaaattcactgatgtaccaggcgcttcgagtgccgtg
ccgattattggcagtgtgcaggcggtttgggcggatgatccgagtgcgcagttagacatg
ccggcgctgttgaagttgatggatcaattttcgacagcctatgcaccttacttagttcgc
ccagccgattacagtaaagttgatgccgctatcgctgccgtgccacggcaacttaatcag
tacaccgaagcatcagttgctaaacttgatgcagcgttaaatgctgttgtccgcggtaaa
aaggcaaccgatcaggcattggttgacggctatgcccagaccattactgtcgccatcaag
gcactgcaattgcggccggccgattacacaaaggttgatgccgccattgcagctgcaaag
aaacttgaccggtcacactatcaagaccttagtgccgttgatgcggcgcttgctgctgtt
aatcgtaatctcaacatcacccagcaagcccaagttgataccatggctgccaagattaca
gctgccatcgctgcgttggttctgaagccggtgccgcaacccgatccaaggcagcagcaa
gtgccaacaaaaaccattgtgaatccagaccggtacttaccaaaaacggcagaagcttcc
gggtgggaattgatgctagctgggcttgccacgatttttggtgtcattagcattgttttc
ttttggcggcaacatcgcatggccatctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system