KEGG   Lactobacillus casei ATCC 334: LSEI_0384Help
Entry
LSEI_0384         CDS       T00407                                 

Gene name
ebgA
Definition
cryptic beta-D-galactosidase subunit alpha
Orthology
K12111  
evolved beta-galactosidase subunit alpha [EC:3.2.1.23]
Organism
lca  Lactobacillus casei ATCC 334
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lca00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LSEI_0384 (ebgA)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    LSEI_0384 (ebgA)
Enzymes [BR:lca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     LSEI_0384 (ebgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
384358..387336
Genome map
AA seq 992 aa AA seqDB search
MTTAKLWEKPELTDINRMAPRSHFQTFFPGENRQPRHYQLLNGTWQFKFLDAPEYAPEDF
MAVDFNDQDWDQIPVPSNWQLQGYGKMHYSDLWYNFPINPPFVPSENPTGLYRRTFTVDE
VAVNEQYIIGFDGADSAFKLYLNGDFIGCSKGARLPSEFDVTKALKQGTNTIAVEVVQWS
DGTYLEDQDMWWLSGLFRDVSLYSRPQNGLYDVRVRTYLLKDYRAGELVVTPTLSGAVPS
KIHYELTKDGATLIDQTLSTDVSLDVTLNDIQAWSAEAPNLYDLTMTVLQNDAPLEVVRQ
RIGFRQIELNGKTFLVNGKAIKFKGVNMHDYSATEGRVMSEADFKKNIISMKRNNINAIR
TAHYPKAPYFYDLCDELGMYVIDETDLECHGFELTERYDWITDDPRWKTAYVDRMRRTLQ
RDKNHPAIIMWSLGNESDFGDNFRAMAAYCKAEDPTRLVHYEGDFEAEVSDVYSTMYTWL
EHDTKMTMADVLQKTQKPHILCEYAHSMGNGPGNLKEYQDLFYGHQQLQGGFIWEWFDQG
VAAQQGDQTYYRYGGDFGDQPNNSNFCIDGLIRPDGQPSTALTEVKKTFEPFQMTVRDLP
TQTITVTNRLDFLSSDQFNFGYELEADGKLMATGKIDLPTIMAGTTKTIKLDIELPKLDP
EVIYNLHVLTELKNQTSWADAGTVLSQTVVNLQRPQHHMTHQQTTALQASENATTIMVTG
GQNEYRFDKIKGTFSLTHDGHKLIADGIKMNFWRAPIDNDMYLLDDYYNKYFLNLWHEST
REVQLHPQTNGDYVVNLTKQVGTTNSGWYYLIQQQYTMHQDGSFDLDVIGKASGKRDMAP
EMLPRIGVKMTLPKAYQQVSYDGLGPTENYSDSHQAAYYSHFTSSVDDLFVNYVKPQENG
NHMDTDQIALTDGQDQLTVTMAKPLNFSVSNYADETLEAAKHTIDLKKSDALNLYLDFRQ
NGLGTNSCGQNQLKRHRCKFDDFELGFNFKVN
NT seq 2979 nt NT seq  +upstreamnt  +downstreamnt
atgacaacagcaaagttgtgggaaaagcctgaattgaccgatatcaatcggatggcccca
cggagtcattttcaaacatttttcccaggtgagaatcgtcagccgcggcattatcagttg
ttgaatggaacttggcagtttaagtttttggacgcaccggaatatgcgccagaagatttt
atggccgttgattttaatgatcaggattgggatcaaatcccagtgccaagtaattggcag
ttgcaaggttacggtaagatgcattattccgacctttggtacaacttcccaattaacccg
ccatttgtcccaagcgaaaatccaactgggttgtaccgccggacatttacagtggatgaa
gtagctgttaacgaacaatacatcattggctttgatggcgctgattcagcgtttaagctg
tatctcaatggcgatttcatcgggtgtagcaagggtgcccgtttaccaagcgagtttgat
gtgacgaaggcattgaagcaaggtaccaacacaattgctgtcgaagtcgttcaatggtcg
gatggcacctatcttgaagatcaggatatgtggtggttaagtggtttgttccgtgatgtg
agtttgtactcgcgaccacaaaatggtttgtatgatgtgcgcgtgcgtacttacttgttg
aaggattatcgtgccggtgaattagtggttaccccaaccttgtctggtgcagtgccatca
aagattcactacgaactgaccaaagacggcgccaccttgattgatcaaacactttcaact
gatgtgtccttggatgtgaccctcaatgatattcaggcatggtctgccgaagcgcccaat
ctctatgacttgaccatgaccgtgctgcaaaatgatgcgccgcttgaagtggttcgtcag
cggatcggctttcggcagatagaattgaatggcaaaacgttcttagttaacggcaaagcg
attaagtttaagggtgtcaatatgcatgactacagtgcaactgaaggccgggttatgtct
gaagctgatttcaagaagaacattatctcgatgaaacgcaacaacatcaacgcaattcgc
accgcacattatcctaaagcgccttatttttatgacctgtgtgatgaattaggcatgtac
gtcattgatgagacagatctcgaatgtcatggttttgagttaactgaacgctatgactgg
attaccgatgatccgcgctggaagacggcttacgttgatcggatgcggcggacactgcaa
cgtgataagaatcatcctgccatcatcatgtggtcattaggcaacgaatccgattttggt
gataacttccgtgcgatggctgcttactgcaaggctgaagatccaactcgcctcgtgcat
tacgaaggcgattttgaggccgaggtgagtgatgtgtattcgacgatgtacacctggctg
gaacatgataccaaaatgacgatggccgatgtccttcagaaaacgcagaagccgcacatt
ttatgcgaatacgcgcattcaatggggaatggcccaggtaaccttaaagaatatcaagat
ctcttctatggtcatcaacaactgcaaggcggctttatctgggaatggtttgaccaaggt
gttgcggctcaacaaggcgaccaaacgtattatcgctatggtggcgacttcggtgatcaa
ccaaacaacagcaatttctgtattgatgggttaattcgcccagatggtcagccatcaacg
gcgctgacagaggtcaagaagacctttgaacctttccaaatgacggttcgtgatttacca
actcagaccatcaccgtgaccaatcggcttgattttcttagctccgatcaatttaatttt
ggctacgagcttgaagctgacggtaaactgatggcaactggcaagattgacctaccaacg
attatggcaggaacaactaagacgattaagttggatattgagttgccaaaacttgatcct
gaagtcatctataacctgcatgtgcttaccgaattgaaaaaccaaacaagttgggctgac
gccggtactgtgttgtcacagacagttgtgaacctgcagcggccacagcatcacatgacg
catcaacaaacaacggctttgcaagctagcgaaaacgccaccacgatcatggtgacaggc
ggtcaaaacgaatatcgttttgataagatcaaaggcacgttcagtttgacacacgatggc
cacaaactgattgctgatggtatcaaaatgaacttctggcgggcacccatcgacaacgat
atgtacttgcttgatgactattacaacaagtatttcttgaacttatggcacgaaagcacc
cgagaagtacagctacacccacaaaccaatggtgattatgtcgtcaacttgacgaaacaa
gtgggcacgacgaatagcggttggtattacttgattcagcaacaatatacgatgcaccaa
gatggcagttttgatcttgatgtcattggcaaagcaagcggtaaacgtgacatggcaccg
gaaatgctgccacgaattggggtcaaaatgacattgccaaaagcttatcagcaagtgtcc
tatgacggccttggtccgacagaaaattatagcgactcgcatcaagcagcgtactatagc
cactttaccagcagtgttgatgatttgtttgtgaactatgtgaaaccgcaagaaaacggc
aaccatatggacactgatcagattgcgttgactgatggtcaagatcagttgacggtgacc
atggcaaagccgctgaacttcagtgtgtcaaactatgctgacgaaacattggaagctgct
aagcacaccattgaccttaaaaagtcggatgcgttgaatctttatttggatttccgccaa
aacggtttggggacgaactcgtgtgggcagaatcaactcaagcgccatcgttgcaagttt
gatgactttgaacttgggtttaacttcaaagtcaattaa

DBGET integrated database retrieval system