KEGG   Lactobacillus casei ATCC 334: LSEI_0585Help
Entry
LSEI_0585         CDS       T00407                                 

Definition
hypothetical protein
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
lca  Lactobacillus casei ATCC 334
Brite
Enzymes [BR:lca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     LSEI_0585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(573760..576186)
Genome map
AA seq 808 aa AA seqDB search
MAKKKVMRKIELPLVDLLENKRKIDLLSNEKPFIIPEYIKGNLKHQLRPYQNQALVNLDW
TQRQPLADYQYNQLLFNMATGSGKTDVLAALILYLYTEFTYHNFLFVVNTNAVVAKTYDN
LLNTASPKYLFSQPLTIHGQRIELRSVTRFPSTPEDGVIYLRLATIQALTNELSETKENS
LTYDDFKAHKLVVLADEAHHFSAGTKSKEDKKERSWEYVLDRIRQANQHNRQFEFTATLD
LQNEAIYQKYRQKIVYRYDLSRFIHQGYSKQVYRLQANNDDENKILNAVLLSQYRKRIAN
DLKIPDFKPVILFKSNKIAVSKDARTTFLSMISQLNITDLTDFLKHQQNTSHSQALKQAY
DYWLSQDLGTAIVELKRDFQAMNTINVNDSAKEGILGDLNDLHNLNTLESSDNPFRVIFA
VAKLSEGWDVLNLYDIVRIGEQSTTLNQTNSEAQLIGRGARYNPFVYQGENSYTRRFDNQ
NPKYQLLESLYYHTINDPKYLDNLKKSLDKMDLPVEDDSDFDVFETNVKRAFKNSKVYQQ
GNLYYNEVEPVPDKEFNCLDRYGVNTTTMAEVNLVESTWETNYNAVAIEKDPLTETRFLF
KFRDAVILVKKAFSRNKFYRFNSLKQYIPTLNSLNEFMTADNWLGNIRLYARVSNGSPAL
NRKQQLKAVEQYLTFVQKQIINNYQRQRGTKRFIPVPIKSLIRDYQKKVAKHFNKSVSEM
ILPYSMKNKPWFVFEEAIVDKLEKSLVDLIGAFVERLSQKYSQIYLFRNDERNTNFKLHQ
FKGRTTHYAGFMPDFILYLVSDELAPTI
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaaaaaagttatgcgcaaaattgaactcccactggtcgatttattggaaaac
aaacgtaagattgatcttcttagtaatgaaaagccctttattatcccagaatatattaaa
ggtaatttaaagcaccaattacgtccttaccaaaatcaagctttagttaatctagactgg
acacagcgacagccattagctgattaccaatataatcaattactttttaatatggccact
ggtagtggtaaaacagacgttttagctgccctgatcttgtatttgtatactgaatttact
tatcataactttctttttgtggtaaatacaaatgctgtggtggctaagacttatgacaat
ttattaaatactgcttcacctaaatatcttttttcccaacctttgactatccatggtcaa
agaatcgagcttcgctcagtaactcggtttcctagtacaccagaagatggtgtgatctat
ttaagattagcaactattcaagccttgaccaatgagttaagtgaaaccaaagaaaacagc
ctcacttatgatgattttaaggctcataaactagttgttttagccgacgaggctcatcat
tttagcgctggtactaaaagtaaagaggataaaaaggaacgttcgtgggaatatgtcctt
gaccgcattcgtcaagctaatcaacataatcgtcaatttgagtttactgcaactctagat
ttgcaaaatgaagcgatttatcaaaaatatcgtcaaaagattgtttatagatacgattta
agccgttttattcaccaaggatattctaaacaggtatatcgattacaagcaaataacgac
gatgagaacaaaatactgaatgctgttttgcttagccagtatcgtaagcgaattgccaac
gacttaaaaatacctgactttaaaccggtaatcttgtttaagtctaataaaattgcggtt
tctaaagatgctcgaacaacttttttaagcatgatctcacagttgaatataacggaccta
accgattttcttaaacatcaacaaaacactagccatagtcaagcattgaaacaagcttat
gattactggttatcgcaagatttgggtactgcaattgttgaattaaaacgtgactttcag
gctatgaatactattaatgttaacgatagtgccaaagaaggaattttaggcgatttaaat
gacttgcataatctaaataccttggaaagttctgataatccctttcgggttatttttgct
gtcgctaagttaagtgagggctgggacgttttaaacctttatgatattgtgcggattggt
gaacaatccactaccttgaaccaaacaaacagtgaagctcagttgattggtcgaggagca
cgctacaatccttttgtttatcaaggcgaaaactcttatacacgtcgttttgacaaccag
aatcctaaatatcagttattagagagtctttattaccacactatcaatgatcctaagtac
ctagataaccttaagaagtcacttgataagatggacctacctgtcgaagatgatagtgat
tttgatgtttttgaaactaatgttaaacgggcctttaaaaactctaaagtttatcaacag
ggtaatctttactacaacgaagttgagcctgtaccagataaagaatttaattgccttgac
cgttatggggttaataccaccacaatggctgaagtcaatttggtagagagcacttgggaa
acaaattataatgctgttgctattgagaaagatcctttaacagaaactagatttttgttt
aagtttcgagatgccgtaatcttagttaaaaaagccttctcacgtaataagttctatcgg
tttaactctctgaagcaatatattcctactttgaattctttaaatgaatttatgacagct
gataattggttgggaaatattcgtttgtatgctcgtgtcagcaatggttcaccagcctta
aatcgtaagcagcaacttaaagcagttgaacaatatttaacttttgttcaaaaacagatt
attaataactatcaaagacaacgcggtaccaagcgctttattccagttcctataaaatcc
ttgattagggactaccaaaagaaagttgccaaacattttaataaatcagtcagtgaaatg
atcttaccctactcaatgaaaaataaaccttggtttgtttttgaagaagccattgttgat
aagctggagaagtctttagttgacttaatcggcgcctttgttgagcggttaagtcaaaaa
tatagtcaaatttatttatttagaaatgatgaacgcaatactaatttcaagctacatcaa
tttaaaggtcggacaactcattatgccgggttcatgcctgattttatcctctatttagtg
agtgatgaattagcccctaccatctag

DBGET integrated database retrieval system