KEGG   Lactobacillus paracasei ATCC 334: LSEI_0668Help
Entry
LSEI_0668         CDS       T00407                                 

Definition
(RefSeq) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
lca  Lactobacillus paracasei ATCC 334
Pathway
lca00010  Glycolysis / Gluconeogenesis
lca00052  Galactose metabolism
lca01100  Metabolic pathways
lca01110  Biosynthesis of secondary metabolites
lca01120  Microbial metabolism in diverse environments
lca01130  Biosynthesis of antibiotics
Module
lca_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:lca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LSEI_0668
   00052 Galactose metabolism
    LSEI_0668
Enzymes [BR:lca01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     LSEI_0668
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 4419616
NCBI-ProteinID: YP_805950
UniProt: Q03BB4
Position
672053..673063
Genome map
AA seq 336 aa AA seqDB search
MDVSVEPYGQYQGHNLYELTLTNDQGMVVKLLNYGATLEKVLLPEADGLHNMILSLPSRE
DYAKERNFLGGTVGRVVGRIRGHVWQHGDVKIDLPMNEGKNHIHGGDDGLDRQVYNFRID
QTATTASASFTFVDPAGHNGYPGNVKLQVTYTLENTNTLHYRLDAVSDEETLFNPTNHTY
FAIDQPNKIDATTLTIPADDYKPLDADHLPDQGWQPVAGTVFDFRQGQKLGDVIHTRAAQ
ITAERGINHPFLLKHGQTLAAKLQTDKHTMTLATTAPSVVVYTANHFDGTGIPHNIDQFD
GVALECQFAPVSGDDLSAITLLPGEPFTLVNSWAFE
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggacgtttcagttgaaccatacggtcagtatcaaggccacaatttgtatgagctgacc
ttgaccaatgatcaaggcatggttgtgaagttgttgaattatggtgcaaccttggaaaaa
gtgttgttaccagaagctgatggcttgcacaacatgattctgtcgctgccaagtcgggaa
gattacgcaaaagagcgcaattttctcggcggtacggtcggtcgagtggtcggccggatt
cgtggtcatgtttggcagcatggggatgtgaaaattgatctgccaatgaacgaaggtaag
aatcacattcacggcggggatgacggtctggatcggcaagtttataacttccgtattgac
cagacagctaccacagctagtgctagttttacctttgttgatccagcagggcataatggc
tatccgggcaacgtcaagctgcaagtgacttataccttggagaatacgaataccttgcac
tatcgtctggatgcagttagtgatgaagaaacgctcttcaatccaactaaccatacctat
tttgcgattgaccagccaaacaaaattgatgccaccacgctgacgattccagccgacgat
tacaaaccgcttgatgcagaccatctgccagatcaaggctggcagccagttgctggaacg
gtctttgattttcggcaagggcaaaagcttggcgatgtcattcacactcgagcagcgcaa
atcactgcagaacggggcattaatcacccattcctactgaaacacggtcaaaccctcgcg
gccaaactccagactgacaaacatactatgaccctggcaaccactgcgccgtccgtcgtc
gtatacaccgccaaccactttgatggtaccggtattcctcacaacattgatcaatttgat
ggcgtggctcttgaatgccaatttgctccggtcagcggcgatgatctttcggcgatcaca
ttattgccgggcgaaccatttacgttggtgaatagttgggcgtttgaatag

DBGET integrated database retrieval system