KEGG   Lactobacillus casei ATCC 334: LSEI_0768Help
Entry
LSEI_0768         CDS       T00407                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lca  Lactobacillus casei ATCC 334
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lca03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
762720..763316
Genome map
AA seq 198 aa AA seqDB search
MYEYFEGIIQAVTPAYIVIDVHGIGFRLLVANPYHFEAGEQKRVYVQLIIRDNDQTLYGF
EGAADKRTFNQLLTVTGIGPKSALAILANVSSGGLATAIAQDDVKFLTKFPGIGKKTAAQ
IILDLKGKITTDGQPAAAAIAPVASDVDSELADALAALVALGYPQRTVDGLTDTLKAFSA
KTTDAYLREGLRLLSGKA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtacgagtattttgaaggcattattcaggcggtgaccccggcttacatcgtcatcgat
gtgcatggcatcgggttccgtctgctggtagccaacccttatcattttgaagctggcgag
caaaaacgtgtttatgtgcagctgatcattcgcgacaacgaccagacactttatggattc
gaaggtgctgcggataagcgtacctttaaccagctattgacggtcacaggcattggcccg
aagtcagcgttggccattttggcgaacgtgtctagcggcggcttggcgactgcgattgct
caagatgatgtgaagtttctgactaagtttcctgggatcggtaagaaaacagctgcccag
attatccttgatctcaaaggtaaaatcacaacagatggacaaccagcggcagcagcgatt
gcgccagttgccagtgacgttgattcggaactcgcagatgcgttggcggcactcgtggca
ttgggctacccgcaacgcaccgttgatggtctcactgacacactgaaggcattcagtgcc
aagacaactgatgcctatttacgcgaaggcttgcggctattaagcggcaaggcttag

DBGET integrated database retrieval system