KEGG   Lactobacillus casei ATCC 334: LSEI_0775Help
Entry
LSEI_0775         CDS       T00407                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lca  Lactobacillus casei ATCC 334
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lca00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LSEI_0775
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LSEI_0775
   00620 Pyruvate metabolism
    LSEI_0775
   00650 Butanoate metabolism
    LSEI_0775
  Lipid metabolism
   00071 Fatty acid degradation
    LSEI_0775
  Amino acid metabolism
   00350 Tyrosine metabolism
    LSEI_0775
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LSEI_0775
   00626 Naphthalene degradation
    LSEI_0775
Enzymes [BR:lca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LSEI_0775
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     LSEI_0775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
769479..772085
Genome map
AA seq 868 aa AA seqDB search
MLKNTAKTATEVDVKSMVDELVANAHAALKIMKTFDQEKIDHIVHRMAIAGLDHHMELAK
LAVDETGRGVWEDKAIKNMFATEEIWHSIKNNKTVGVINEDKQRGLVSIAEPIGVIAGVT
PVTNPTSTTMFKSEIAIKTRNPIIFAFHPGAQKSSARALEVIRDEAEKAGLPKGALQYIP
VPSMDATKALMDHPGIATILATGGPGMVKSAYSSGKPALGVGAGNAPAYIEASANIKQAV
NDLVLSKSFDNGMICASEQGVIIDSSIYDDVKKEFEAQGAYFVKQKDMKKFESTVINLEK
QSVNPRIVGQSPKQIAEWAGITIPDNTTILIAELKGVGEKYPLSREKLSPVLAMVKADGH
EDAFKKCETMLDIGGLGHTAVIHTADDELALKYADAMQACRILINTPSSVGGIGDLYNEM
IPSLTLGCGSYGGNSISHNVGTVDLLNIKTMAKRRNNMQWMKLPPKIYFEKNSVRYLEHM
EGIKRAFIVADRSMEKLGFVKIVEDVLARRENPVQVQTFVDVEPDPSTDTVFKGTDIMRS
FGPDTVIAIGGGSVMDAAKGMCLFNDAGDADFFGAKQKFLDIRKRTYTFPNLNKTKLVCI
PTTSGTGSEVTPFAVITDSKAGIKYPLADYALTPDIAIVDSQFIESVPPVVVADSGLDVL
CHATESYVSTMATHYTKGLSLEAIKLVFENLEKSYHGDVEAKSKMHDASTIAGMAFANAL
LGINHSIAHKIGQAFHLPHGRCIAITMPHVIRFNASQPKKRAIWAKYSYFRANEDYAEIA
RYLGLPGKTTDELVESYVQAFIKLAHSVGVKLSLKEQGVKKADLDKQVDRLAELAYEDNC
TVTNPQEPLIGDLKHIILDEYEGTESTF
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagaatactgcgaagactgctaccgaagttgatgtaaagagcatggttgacgaa
ctggttgcgaatgcgcatgccgctttgaagatcatgaaaactttcgatcaagaaaagatc
gatcacatcgttcatcggatggcaatcgctggtttggatcatcatatggaattggcaaaa
ctcgctgttgacgagacgggccgtggcgtgtgggaagataaagcgatcaagaacatgttc
gccaccgaagaaatttggcactcaatcaagaacaacaagaccgttggtgtgatcaacgaa
gacaaacaacgcggcttggtatcgattgctgaaccaattggtgtcattgctggtgtgacg
ccagtgacgaacccaacttcaacgaccatgttcaaatccgaaattgccattaaaacccgt
aatccaatcattttcgctttccatccgggtgcccaaaagtcttcagcgcgtgcgttggag
gtcatccgtgatgaagccgaaaaagcaggcttaccaaagggtgctttgcaatatatccct
gtaccaagtatggatgcgactaaagctttgatggatcaccctggtatcgccacgattttg
gcaacgggcggtcctggcatggttaagtccgcctattcatcaggcaagccagcactgggt
gttggggccgggaatgcgccagcttacattgaagccagcgctaacatcaaacaagctgtc
aatgacttagtactttcaaagagttttgataatggtatgatttgtgcttccgaacaaggc
gtgattattgattccagcatttacgatgatgtgaagaaggaatttgaagcccaaggtgct
tacttcgttaaacagaaggacatgaagaagttcgaaagtaccgtcattaatcttgaaaag
caaagtgtcaatccgcgaatcgttggtcaaagtcctaagcagattgctgaatgggcgggg
atcacgattcctgataacaccacgattctgattgctgaattgaaaggtgttggcgaaaag
tatccactgtctcgtgaaaaactaagtccagtactggccatggtcaaagcagatggtcat
gaagatgccttcaagaaatgtgaaaccatgcttgatatcggcggtttgggtcatacggca
gtcattcacacggctgatgatgagttagctttgaagtatgccgatgctatgcaagcttgc
cggattttgatcaacacaccatcttctgtcggcgggattggcgatctttacaacgaaatg
attccaagtttgacactgggctgcggctcatacggtggtaactcaatttcgcataacgtg
gggacggtcgacttgcttaacatcaagacaatggcaaaacgccgcaataacatgcagtgg
atgaaattgccaccaaagatctattttgaaaagaattctgttcgttacctcgaacacatg
gaaggcatcaaacgggccttcatcgttgctgatcgaagcatggaaaagttaggcttcgtc
aagatcgttgaagatgttctggctcggcgtgaaaatcctgttcaagttcagacttttgtc
gatgttgaacctgatccatcaactgacacggtcttcaaggggaccgatatcatgcgctca
tttggaccggataccgtcattgctatcggcggcgggtctgttatggatgctgccaaaggg
atgtgcttgttcaacgatgccggggatgctgatttcttcggcgctaagcagaaattcttg
gatatccggaagcggacttacaccttcccgaatctgaataagacaaagcttgtctgcatt
ccaacaacttctgggactggttcagaagtaacaccttttgcggttatcaccgattccaag
gctggcatcaagtatccgttagctgactatgcattgacgccagacatcgcgattgtggac
agtcagttcatcgaatccgtaccgccagtggttgtcgctgattccggtttggatgtgctc
tgccacgcaaccgaaagttatgtttcgaccatggccactcattacacgaagggcctgagt
ttggaagcaatcaagttggtcttcgaaaatctggaaaagagttatcatggcgacgtcgaa
gcaaagtcaaagatgcatgatgcttcaaccattgccgggatggcctttgccaacgcactg
ttgggcattaaccacagcattgcgcataagattgggcaagcgttccatctgcctcacggt
cgttgcatcgcgatcacgatgccacatgttattcgcttcaatgcgagtcaaccgaagaag
cgcgctatctgggcgaagtatagctacttccgcgctaacgaagactacgcagaaatcgct
cgctaccttggccttcctggcaagacaactgatgaattggttgaaagctatgtccaggcc
ttcatcaagctggctcacagtgttggcgtcaagctcagtttgaaggaacaaggcgttaaa
aaggctgatctcgacaagcaagttgatcgtcttgccgaactggcttatgaagacaactgc
accgttaccaacccgcaagaaccgttaatcggcgacttgaagcatatcatccttgatgaa
tatgaaggcaccgaatccactttctaa

DBGET integrated database retrieval system