KEGG   Lactobacillus paracasei ATCC 334: LSEI_0893Help
Entry
LSEI_0893         CDS       T00407                                 

Definition
(RefSeq) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
lca  Lactobacillus paracasei ATCC 334
Pathway
lca00480  Glutathione metabolism
lca00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:lca00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    LSEI_0893
  Metabolism of other amino acids
   00480 Glutathione metabolism
    LSEI_0893
Enzymes [BR:lca01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     LSEI_0893
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin DUF4174
Motif
Other DBs
NCBI-GeneID: 4421708
NCBI-ProteinID: YP_806135
UniProt: Q03AS9
Position
869567..870040
Genome map
AA seq 157 aa AA seqDB search
MSIYDYEVTLEDGSQYALSKYKGRPMLIVNTATKCGFAPQFDGLEKLYDKFKDQGLVVLG
FPSDQFKQELADGHAAAEACRLKYGVSFPMHALIKVNGKEAAPLFQYLKTQAPGELGKSI
KWNFTKFLVDRDGQVVARFAPKTKPEAIEPAVEKLLG
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatttatgattatgaggtcacattagaagatggctcgcaatatgctttgagcaaa
tacaagggtcgaccaatgttgatcgtgaacactgccactaaatgcggcttcgcgcctcag
tttgatggtttggagaaattgtatgacaagttcaaggatcaaggtttggtagtgctaggt
tttccttctgatcaatttaaacaggaactggctgatggtcatgcagcggccgaggcttgc
cggttgaaatacggtgtgagttttccaatgcatgctttgattaaggtgaacggcaaagaa
gcagctccgctgtttcaataccttaaaacccaagcccctggtgaactaggcaagtccatc
aaatggaactttacgaagtttttggttgatcgtgatggtcaagttgtcgcccgctttgca
ccaaaaacaaaaccagaagcgattgaaccagcagtggagaagcttcttggctaa

DBGET integrated database retrieval system