KEGG   Lactobacillus casei ATCC 334: LSEI_0975Help
Entry
LSEI_0975         CDS       T00407                                 

Definition
esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
lca  Lactobacillus casei ATCC 334
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
957748..958482
Genome map
AA seq 244 aa AA seqDB search
MIFREPQPFEYEGTDTGVVLLHAYTGSPNDMNFMGRALQRAGYGVYAPLFTGHGTIEPMD
ILTKGNPDIWWAEASAAVSHMTAKYDRVFVFGLSLGGIFAMKALEILPGVTAGGVFSSPI
LPGKHHLVPGFLKYAQYMNRLAGVPDESTQILAYLPGQLAAIDNFATGVAADLYLVNKPI
FIGQAGADELVDGQLAYQLRDALINAPQVDFHWYDNAKHVITVNSAHHALQQDVIAFMQQ
ENEG
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgatctttcgtgaaccgcaaccattcgaatacgagggcactgataccggtgttgttttg
ctgcatgcctatactggcagcccaaacgacatgaacttcatggggcgggccttgcagcgg
gctgggtatggcgtgtatgcgccgttgttcacgggacatggtaccattgagccaatggat
attctgactaagggcaacccagatatttggtgggcagaggccagcgcggctgtttcgcat
atgacagcaaagtatgaccgtgtttttgtttttggattatcactcggcggtattttcgcc
atgaaagctttggaaatattacccggtgtcacagctggcggcgttttttcatcgccgatc
ttaccgggtaagcaccatctcgtgccagggtttctgaaatacgcacaatatatgaatcgt
ttggcaggtgtaccagacgaaagtactcagattctggcttacttaccgggccagctggcg
gcgattgacaatttcgccactggggttgccgccgatctgtatttagttaataagccgatc
tttatcggccaggccggtgctgatgaattagttgatgggcagctggcttatcagctacgg
gatgcactcatcaatgcaccgcaagtagattttcattggtatgacaatgccaagcatgtg
atcaccgtgaattcggcgcatcacgcactacaacaagacgttatcgcatttatgcaacaa
gaaaacgagggatag

DBGET integrated database retrieval system