KEGG   Lactobacillus casei ATCC 334: LSEI_1036Help
Entry
LSEI_1036         CDS       T00407                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lca  Lactobacillus casei ATCC 334
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:lca00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LSEI_1036
  Lipid metabolism
   00561 Glycerolipid metabolism
    LSEI_1036
   00600 Sphingolipid metabolism
    LSEI_1036
Enzymes [BR:lca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     LSEI_1036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1021421..1023712
Genome map
AA seq 763 aa AA seqDB search
MIDVINNQAFHLHNDQISYICALLPNGQLGHLYFGPRLSLTKNDLAYLSQGSSPFAWMAN
FSDDQEFALGDAQQEYPVYGTGDFRQGSLSVTQDDMPIYPNFVFKDDQLTHTKTRDLHHP
TSFGNPALTDVLTIHLEDKTAQLLLTLQYTIFADSAAIVRSATLTNQGTAPVMIQRMLSG
VLNLPQGRYDVVHLSGNWAKERHIQTQPLTQGTFSVESLRGASSHEQNPFVALHAAGQPF
AAGDTYGANLIYSGNFLDSTEVNEWDQTRLLTGIHPASFSWRLDPKTSFTTPETVFSYSS
GGLAGLAQANQRFVARHIIDPQWRQKQRPVVLNSWEATYFDLNEKKLLKLAALGKQVGVD
CFVLDDGWFGTRDNDLSSLGDWFTNKHKFPDGLGHFAQEIHAMGLQFGLWFEPEMVSPRS
QFFQAHPNWVVRPKKGRISITRNQYVLDFSNPAVVNNIFEQMQKVITETNLDYVKWDLNR
SITEAFSPYLEKIGHPQGEFFHRYVQGVYTLYQKLLTAFPHLLIEGCAGGGGRFDLGILF
YSPQIWTSDDSDAIERLAIQSGMALAYPLSCMSNHVTAVPNEQVGRSTPLVTRFRVAAFG
ILGYELDLTKLDARTLATIKAQIAYYHALQPLVLKGDFSLLLPRQSNGQNQVAWLLSAHD
RKHLVLGFFRVLADADSRTVQYMKVPLAKSDTPYWVNQHTGPISGDVLQRVGVRLPVQFN
GANRAQAQLIGDYQSVLLTFDSVASLDHIESQQTDADKQTVGH
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
ttgatagatgttataaataatcaagcttttcatcttcacaacgatcaaatcagttatatt
tgcgctttgctgccgaatggtcagctcgggcatctttattttggtccgcgcttgtcatta
actaaaaacgacttagcctatttgtctcaaggctcaagtccgtttgcgtggatggccaat
ttttcagacgatcaggaatttgccttgggtgatgcacaacaggagtatcctgtttacggc
actggtgattttcggcaaggcagcctgagtgtgacccaagatgatatgccaatttatccg
aactttgtttttaaagatgatcaattgacgcatacgaaaacgcgggacttgcaccatccg
acgagtttcggcaatccggcattgaccgatgtgctgacgattcatcttgaagataaaacg
gcccaattgttgttaacgttgcaatatacgatttttgccgacagtgcggcaattgttcgt
tcagccacactaaccaatcaagggacagcaccagtgatgattcaacgcatgctgagtggc
gttttgaacttgccgcaaggacggtatgacgttgttcatttatctggtaattgggcgaag
gagcgtcatattcaaacgcaaccgttaactcaaggaacattttcagttgaatcgctccgt
ggtgcttccagtcatgaacagaatccttttgtggccttacatgcagcgggacagccgttt
gcagcaggcgatacctatggggcgaacttgatttattcgggcaactttctggacagcacc
gaggtcaacgaatgggatcagactcgattgctaactggcattcatcccgcatcgtttagt
tggcggttggatccaaaaaccagttttaccacgccagaaaccgtgtttagttatagctct
ggtggtcttgccggcttagctcaggccaatcaacgttttgttgctcgccatattattgat
ccgcaatggcgtcaaaagcagcgcccggtcgtcttaaacagctgggaagcgacttacttt
gatttgaacgagaagaagttgctcaagttagcggcactcggcaagcaggtcggtgtggac
tgctttgtgctggatgatggctggttcggaacgcgcgacaatgatttgagttccttgggt
gattggtttactaataagcataaatttcccgacggtctcggccattttgctcaggaaatt
cacgcgatgggcctgcagtttggcctttggtttgaacccgagatggtttcaccgcgatct
caattcttccaagcccatccgaattgggtcgttcgaccaaaaaagggtcgtatctcgatc
acgcgtaatcaatatgtgttagacttcagcaacccggctgtcgtcaacaatatttttgaa
cagatgcaaaaggtcatcactgaaaccaacttggattatgtgaagtgggatcttaatcgc
agcattacagaggccttttcaccgtatctcgaaaagatcggtcatccgcaaggcgagttc
ttccatcgttacgtacaaggcgtgtacacgctctatcagaagctgctgacggcattcccg
catttattgattgaagggtgtgccggcggtggtggccgctttgatctgggcattctgttc
tacagtccgcaaatttggaccagtgatgattccgatgcgatcgaacgtttggccattcaa
tcaggcatggctttggcctatccattgagctgtatgagcaatcatgtgacggccgtgccg
aatgaacaggttggtcgatcaacgccgctggtcacgcggtttcgggtggcggcctttggg
attcttggttatgaactggatctgaccaaacttgatgcgcgaacattggctacgatcaag
gctcaaattgcctattaccacgccttacaaccgctagtactgaaaggcgactttagccta
ttgttaccgcggcagtccaatgggcagaatcaggtggcgtggttgctcagcgctcatgat
cgcaagcaccttgttcttggttttttccgagtcttggctgatgcagacagtcgcaccgtg
cagtatatgaaggtgccattggcaaaatctgacacaccgtattgggtcaatcagcacaca
ggcccaatttcgggggatgtcctccagcgcgttggtgtgcgcttaccagtccaattcaac
ggcgccaatcgcgcacaagctcagttaatcggtgactatcaatcggtactgttgaccttt
gatagtgtggcaagtttggatcacattgaaagccagcagaccgatgccgacaaacaaaca
gttggccattaa

DBGET integrated database retrieval system