KEGG   Lactobacillus casei ATCC 334: LSEI_1052Help
Entry
LSEI_1052         CDS       T00407                                 

Definition
lysophospholipase L1 related esterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
lca  Lactobacillus casei ATCC 334
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:lca01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1033392..1034183)
Genome map
AA seq 263 aa AA seqDB search
MKKFWLGFGLLLLILAAGCGVQHKVAKSSSSAASLRSRKSPSSRSSAAIKQTSMLARLKA
KSQTTLVYAPFGDSLSVGLFADSKTSRFTTLFADQLHHLTDKTVTEEGIAEVGKTATNLG
VPALPALIAQHPDLITIEFGTNDAVGGATPTALADYRQALTTIVATLQKQTTAELILMTT
WSPNHGPYAAADLQFDAVVKQIGQTYHVPVADLATIWQNHDDVTGPAGTAITDFAGNGPR
DTFHPNQRGHDQIAALLKKTLEE
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagttttggttgggttttggtcttttattgctcattttagcagctggctgcggg
gtacaacataaagtggctaaatcgagcagttcagcagcttcgcttcgcagccgcaagtcg
cctagttcgcgatcctcagctgcgattaagcagacaagcatgctcgcccggctgaaggca
aaatcacaaacgacgctcgtgtatgcaccgtttggcgacagcctctctgttggtttgttt
gcggatagtaaaacaagccggtttaccaccctttttgctgaccaattacatcatttgact
gacaagacggtgacagaggaagggattgcagaggtgggaaaaaccgcgactaatcttggt
gtccctgctctgccagcgttgattgcccagcatcctgatttgattaccatcgagtttggg
acgaacgatgcggttggcggcgccacaccaacggcgctggctgattaccgtcaggcgttg
acaaccatcgtggcaaccttgcagaagcaaacaacagccgagttgatccttatgacgaca
tggtcgccaaaccatggtccttatgccgccgccgatttgcaatttgatgctgtggtcaaa
caaatcggtcaaacttatcacgttccagttgccgatctggcgaccatctggcaaaaccat
gatgacgtcacaggccctgccggtacagccatcaccgacttcgctggtaacggtccgcgc
gatacttttcaccccaaccagcgcggtcatgatcagattgctgccttactcaagaaaact
ttggaggaataa

DBGET integrated database retrieval system