KEGG   Lactobacillus casei ATCC 334: LSEI_1295Help
Entry
LSEI_1295         CDS       T00407                                 

Definition
exonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lca  Lactobacillus casei ATCC 334
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lca00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LSEI_1295
Enzymes [BR:lca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LSEI_1295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1275333..1277801
Genome map
AA seq 822 aa AA seqDB search
MDTREETVTGRVKSIFFQNPTNFFKILLIEISATTITWTESDIVVTGTFGDIKEDATYTF
TGHVVDHPKYGQQFQADNYHADQPTNKSGLVDYLSSDKFPGIGPKTATKIIDHLGMDAID
KILDDPKVLAGLGMTAAKRDMLATNLKSNQGMERVIIGLNDYGFTSNMAGRIYQRYQNDA
LDVIKHNPYQLINDIDGIGFTRADQIAAKLAIAPTSQLRLGGAVMDTLQRLTDGEGDTYV
TLKSLVTQTLDLLERARNVAVSPDAVGQAIVTLAKDNALIAEGDRIFPKRLFDAEWQIGR
QLKGLAEADATATEPELAEIEKTLAAVEADTGIAYDATQRKAIVTALQSPIFLLTGGPGT
GKTTVTDGIVRTYARLHDLSLDLDQYTTDEPFPIMLAAPTGRAAKRISETTQLPASTIHR
LLGLGVDTQEFAPNELPNGLLIIDEMSMVDTYLFRTLLTALHPGMKIVLVGDKDQLPSVG
PGQVFADLLRSGVLPQTALTHIHRQDADSSIIPLAHAVNAGKLPDDFTKPQVDRSFLACA
PSQVPEVVGQVVQRAAVKQFSIADIQVLAPMYRGTAGIDRLNPLLQNILNPKRSARTKAI
QFGETEYRIGDKVLQLVNDPNQNVFNGEIGQIVGITLGKEAESKTDELTIDFDGNEITCK
RSDFNKITLAYATSIHKAQGSEFPMVILPLTLQSRRMLRRNLLYTAITRAKSFLILVGEL
AAFQEAVSEVAVNRHTGLVDRLMTVFGKTVAPQVADDSATKDISASPSEPQIDTTALDLD
NEVKQQPPAAHQLTPALVASQRIDPMIGMDGITPQMFMTKEN
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atggacacgcgtgaggagactgtcaccggtcgggtcaaaagtatctttttccagaatcca
acaaatttttttaaaattctgctgatcgaaatctctgcgacgactatcacctggacagag
tcagatattgtggtgacaggaacgtttggtgatattaaggaagatgcgacctacacgttc
actgggcatgtcgtggatcatcctaagtatgggcagcagtttcaagcagacaattaccat
gcggatcagccgacgaataaaagtgggctggtcgattatttgagttcggataagttcccg
gggatcggtccgaaaacggcaacgaaaattatcgatcatttgggtatggatgctattgac
aagattctggatgatccgaaggttttggcgggcttaggcatgacagctgccaagcgtgat
atgttggcgacgaatctgaaatcgaaccaaggcatggaacgggttattattggtcttaac
gattacggctttactagcaatatggcaggtcgtatttaccaacgatatcaaaatgacgct
ttagatgtgattaagcacaatccgtatcaattgattaacgatattgatggtatcggcttt
actcgggctgatcagattgcggcaaaattggcgattgccccgacttcgcagcttcgtctt
ggcggtgcagtgatggataccctgcagcggttgactgatggcgaaggtgatacctatgtg
acgctgaagtcattggtcactcagacacttgatttattggaacgggcgagaaacgttgcc
gtttcgccagacgcagtaggacaggcaattgtgacgctggctaaagacaacgccctgatt
gcagaaggcgaccgcattttcccgaaacgattattcgatgctgaatggcagattggtcgg
caactaaaaggactggcagaggcagacgcaacggctaccgaacctgaattggctgagatt
gaaaaaacgttagcggcggtcgaggcggataccggtattgcgtatgatgcgacacaaaga
aaagccattgtcacggcgttacagtcgcccatttttctgttgactggaggaccgggtact
gggaaaaccacagtaacagatggtatcgtgcggacgtatgcacggttgcatgacctttca
ttggatcttgatcagtatacgactgacgagccatttccaatcatgctggcagcgccaaca
ggacgggcagcgaaacggattagtgaaaccacccaactgccagccagtacgattcatcgc
ctgctcggtttaggtgttgacacgcaagaatttgcacctaatgagttaccaaatggcctg
ttgattattgatgagatgtcaatggttgacacttacttgttccggacgcttttaacggca
ttacatcccggaatgaaaattgtcttggttggcgataaagaccaattaccaagtgtcggt
cctggacaagtattcgctgatttattgcgcagcggcgtgctgccgcaaacagcgctgacg
catattcatcgtcaggatgccgacagttcaattattccgctagcgcatgcagtgaatgct
ggcaagttgccggatgattttaccaagccgcaagttgatcgcagttttttggcgtgtgcg
cctagtcaggtacctgaagttgtcggacaagtggtgcaacgagccgcagtcaaacaattc
tcgatcgcggatattcaagtgttggcacctatgtaccgcggaaccgctggcattgatcgt
ttgaatccgttactgcaaaacattttgaatccaaaacgcagtgcccgaacgaaagcaatt
cagtttggagaaacggaatatcgaattggtgataaggtgttgcaactggtcaatgatccc
aaccaaaatgtttttaacggtgaaatcggtcagattgtcggcattactttgggcaaggaa
gccgaaagcaaaacggacgaattaacgattgattttgacggcaatgaaatcacttgcaaa
cgcagtgattttaataagattacgcttgcttatgccacctcgattcataaagcccaaggc
agtgagtttccgatggtgattttgccgctaaccttgcaaagccgccggatgttgcgacgt
aacttgttgtacaccgccattacgcgggctaaatcatttttgattttggttggcgaactg
gcagcctttcaggaagcagtcagtgaagtagccgttaatcgacatactgggctggtcgat
cggctcatgaccgtgtttggcaaaaccgttgcccctcaggttgctgatgattcagcaacc
aaggatatttcagcaagtcccagtgagccgcaaattgacacaactgcacttgacttggat
aatgaagttaaacaacaaccaccggcagcgcaccaattaacgcctgccttggtggcttct
caacgaatcgatcccatgattgggatggatggtatcactccgcaaatgtttatgacgaag
gagaattaa

DBGET integrated database retrieval system