KEGG   Lactobacillus casei ATCC 334: LSEI_1659Help
Entry
LSEI_1659         CDS       T00407                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lca  Lactobacillus casei ATCC 334
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LSEI_1659
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LSEI_1659
   00052 Galactose metabolism
    LSEI_1659
   00500 Starch and sucrose metabolism
    LSEI_1659
   00520 Amino sugar and nucleotide sugar metabolism
    LSEI_1659
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LSEI_1659
   00524 Butirosin and neomycin biosynthesis
    LSEI_1659
Enzymes [BR:lca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LSEI_1659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1654426..1655388)
Genome map
AA seq 320 aa AA seqDB search
MNDKKLIGVDLGGTTVKFAILTTDGEIQQRWSIDTNILDEGSHILPDIIDSINEHLKLYN
MTPNDFVGIGMGSPGSVDIEAGTVIGAYNLNWKTLQQAKKDIEAGTGIPFSIDNDANVAA
LGERWKGAGENDANVTFVTLGTGVGGGIIADGNLLHGVAGSAGELGHVTVDPVNGYLCTC
GKRGCLETVASATGVVRVARDMAEEFAGDSKLKQTLDDGDEISSKIVFDLAKTGDKLALM
IVDRVSYFLGLALANVGNLLNPKFIVIGGGVSAAGDFLLKRVDKYFKENTFPNVRETTSL
RLATLGNTAGVIGAASLALK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacaaaaaattaattggtgtcgatctgggcggcacaacggttaaattcgcgatc
ttaaccactgatggtgagattcaacagcgctggagcatcgatactaatattttggatgaa
ggcagtcacatcttgccggatatcattgattcgatcaacgaacatctcaaactctacaac
atgacaccgaatgattttgtcggtatcggtatgggctcacctggttccgttgatattgaa
gcaggcacggtaattggcgcttacaacttgaattggaaaacattgcagcaggctaagaag
gatattgaggctggtactgggattccctttagtattgataacgacgccaatgttgctgcc
ttgggcgaacgttggaaaggcgctggcgaaaatgacgccaatgtaactttcgtaacgctt
ggcacaggcgttggcggcggcattattgccgatggtaacttattgcatggtgttgcaggc
tcagcaggcgaacttggacatgtgactgttgatcctgtgaatggttatctctgtacttgc
ggcaaacgcggttgtctcgaaactgtagccagtgcgactggcgttgtccgggtggcccgg
gatatggctgaagaattcgctggcgactccaaactgaagcagacgttagatgatggcgat
gagatttctagcaaaattgtttttgatcttgccaaaaccggcgacaaacttgcgttgatg
attgttgaccgggttagctactttcttggcttggcattggcaaatgtcggcaatctgctg
aatccgaaattcatcgtcattggtggcggcgtttcagcagcaggtgactttttgctgaag
cgagttgacaagtatttcaaggaaaacacgttcccgaatgttcgggaaacaacaagtctg
cgtctggcaacgctaggtaacactgctggcgttatcggagctgccagccttgcacttaag
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system